Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEF2D Rabbit pAb (APR22987N)

Product Specifications

Background

This gene is a member of the myocyte-specific enhancer factor 2 (MEF2) family of transcription factors. Members of this family are involved in control of muscle and neuronal cell differentiation and development, and are regulated by class II histone deacetylases. Fusions of the encoded protein with Deleted in Azoospermia-Associated Protein 1 (DAZAP1) due to a translocation have been found in an acute lymphoblastic leukemia cell line, suggesting a role in leukemogenesis. The encoded protein may also be involved in Parkinson disease and myotonic dystrophy. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MEF2D Rabbit pAb (APR22987N) .

Synonyms

MEF2D

Gene ID

4209

UniProt

Q14814

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 49kDa/50kDa/55kDa/56kDa Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4209

Uniprot URL

https://www.uniprot.org/uniprot/Q14814

AA Sequence

TTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Creatine Kinase, Brain (CKB) BioAssayTM ELISA Kit (Human)
024447 96 Tests

Creatine Kinase, Brain (CKB) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
COL20A1 Antibody, HRP conjugated
CSB-PA873727LB01HU-01 50 µg

COL20A1 Antibody, HRP conjugated

Sign In for Pricing
View Details
COL20A1 Antibody, HRP conjugated
CSB-PA873727LB01HU-02 100 µg

COL20A1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Recombinant human IL-17F protein
ATGP3605-004 4 µg

Recombinant human IL-17F protein

Sign In for Pricing
View Details
Cystic Fibrosis Transmembrane Conductance Regulator (CFTR) (MaxLight 405)
MBS6244841-01 0.1 mL

Cystic Fibrosis Transmembrane Conductance Regulator (CFTR) (MaxLight 405)

Sign In for Pricing
View Details
Cystic Fibrosis Transmembrane Conductance Regulator (CFTR) (MaxLight 405)
MBS6244841-02 5x 0.1 mL

Cystic Fibrosis Transmembrane Conductance Regulator (CFTR) (MaxLight 405)

Sign In for Pricing
View Details