Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PVRL4 Rabbit pAb (APR22737N)

Product Specifications

Background

This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PVRL4 Rabbit pAb (APR22727N9) .

Synonyms

NECTIN4; EDSS1; LNIR; PRR4; PVRL4; nectin-4

Gene ID

81607

UniProt

Q96NY8

Cellular Locus

Cell junction, Cell membrane, Secreted, Single-pass type I membrane protein, adherens junction

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa/55kDa Observed MW: 55kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=81607

Uniprot URL

https://www.uniprot.org/uniprot/Q96NY8

AA Sequence

MSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEESVGLRAEGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGSGRAEEEEDQDEGIKQAMNHFVQENGTLRAKPTGNGIYINGRGHLV

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal mGluR2/3 Antibody
NB100-1760SS 0.025 mg

Rabbit Polyclonal mGluR2/3 Antibody

Ask
View Details
RPS11P7 CRISPR Knock Out 293T Cell Line (Human)
42051141 1x 10^6 Cells / 1.0 mL

RPS11P7 CRISPR Knock Out 293T Cell Line (Human)

Ask
View Details
CHD4 Recombinant Antibody, Cy5 Conjugated
bsm-61493R-Cy5-01 20 µL

CHD4 Recombinant Antibody, Cy5 Conjugated

Ask
View Details
CHD4 Recombinant Antibody, Cy5 Conjugated
bsm-61493R-Cy5-02 100 µL

CHD4 Recombinant Antibody, Cy5 Conjugated

Ask
View Details
Anti-c-Myc / Cellular myelocytomatosis oncogene Monoclonal Antibody (Clone:9E10)
30-2409-0.1 0.1 mg

Anti-c-Myc / Cellular myelocytomatosis oncogene Monoclonal Antibody (Clone:9E10)

Ask
View Details
SUMO2, SUMO3, ID (SUMO2/3, Small Ubiquitin-like Modifier 2, Small Ubiquitin-related Modifier 2, Sumo 2, Sumo-2, Small Ubiquitin-like Modifier Protein 3, Small Ubiquitin-related Modifier 3, Sumo 3, Sumo-3, HSMT3, MGC117191, Sentrin 2, Sentrin-2, SMT3 Homolog 1, SMT3 (yeast) Homolog 1, SMT3H1, SMT3 Suppressor of Mif Two 3 Homolog 2, Suppressor of Mif Two 3 Homolog 2, SMT3 Homolog 2, SMT3 (yeast) Homolog 2, SMT3H2, SMT3 Suppressor of Mif Two 3 Homolog 3, Suppressor of Mif Two 3 Homolog 3, SMT3A, SMT3B, Ubiquitin-like Protein SMT3A, Ubiquitin-like Protein SMT3B) (APC) discontinued
S8026-01C-APC 200 µL

SUMO2, SUMO3, ID (SUMO2/3, Small Ubiquitin-like Modifier 2, Small Ubiquitin-related Modifier 2, Sumo 2, Sumo-2, Small Ubiquitin-like Modifier Protein 3, Small Ubiquitin-related Modifier 3, Sumo 3, Sumo-3, HSMT3, MGC117191, Sentrin 2, Sentrin-2, SMT3 Homolog 1, SMT3 (yeast) Homolog 1, SMT3H1, SMT3 Suppressor of Mif Two 3 Homolog 2, Suppressor of Mif Two 3 Homolog 2, SMT3 Homolog 2, SMT3 (yeast) Homolog 2, SMT3H2, SMT3 Suppressor of Mif Two 3 Homolog 3, Suppressor of Mif Two 3 Homolog 3, SMT3A, SMT3B, Ubiquitin-like Protein SMT3A, Ubiquitin-like Protein SMT3B) (APC) discontinued

Ask
View Details