Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PVRL4 Rabbit pAb (APR22737N)

Product Specifications

Background

This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PVRL4 Rabbit pAb (APR22727N9) .

Synonyms

NECTIN4; EDSS1; LNIR; PRR4; PVRL4; nectin-4

Gene ID

81607

UniProt

Q96NY8

Cellular Locus

Cell junction, Cell membrane, Secreted, Single-pass type I membrane protein, adherens junction

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa/55kDa Observed MW: 55kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=81607

Uniprot URL

https://www.uniprot.org/uniprot/Q96NY8

AA Sequence

MSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEESVGLRAEGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGSGRAEEEEDQDEGIKQAMNHFVQENGTLRAKPTGNGIYINGRGHLV

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

COG2, NT (COG2, LDLC, Conserved oligomeric Golgi complex subunit 2, Component of oligomeric Golgi complex 2, Low density lipoprotein receptor defect C-complementing protein) (PE)
MBS6287525-01 0.2 mL

COG2, NT (COG2, LDLC, Conserved oligomeric Golgi complex subunit 2, Component of oligomeric Golgi complex 2, Low density lipoprotein receptor defect C-complementing protein) (PE)

Ask
View Details
COG2, NT (COG2, LDLC, Conserved oligomeric Golgi complex subunit 2, Component of oligomeric Golgi complex 2, Low density lipoprotein receptor defect C-complementing protein) (PE)
MBS6287525-02 5x 0.2 mL

COG2, NT (COG2, LDLC, Conserved oligomeric Golgi complex subunit 2, Component of oligomeric Golgi complex 2, Low density lipoprotein receptor defect C-complementing protein) (PE)

Ask
View Details
Recombinant Human CRYBB3 Protein - (Dry Ice)
H00001417-P01-25ug 25 µg

Recombinant Human CRYBB3 Protein - (Dry Ice)

Ask
View Details
MMP9 Antibody / Matrix metalloproteinase-9
V7962-100UG 100 µg

MMP9 Antibody / Matrix metalloproteinase-9

Ask
View Details
Mouse Monoclonal CDK2 Antibody (AN4.3) [mFluor Violet 610 SE]
NB100-2721MFV610 0.1 mL

Mouse Monoclonal CDK2 Antibody (AN4.3) [mFluor Violet 610 SE]

Ask
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) TFB5 Polyclonal Antibody
MBS9009239 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) TFB5 Polyclonal Antibody

Ask
View Details