Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EML4 Rabbit pAb (APR22703N)

Product Specifications

Background

This gene is a member of the echinoderm microtubule associated protein-like family. The encoded WD-repeat protein may be involved in microtubule formation. Abnormal fusion of parts of this gene with portions of the anaplastic lymphoma receptor tyrosine kinase gene, which generates EML4-ALK fusion transcripts, is one of the primary mutations associated with non-small cell lung cancer. Alternative splicing of this gene results in two transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EML4 Rabbit pAb (APR22703N) .

Synonyms

EML4; C2orf2; ELP120; EMAP-4; EMAPL4; ROPP120

Gene ID

27436

UniProt

Q9HC35

Cellular Locus

Cytoplasm, cytoskeleton

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 102kDa/108kDa Observed MW: 120kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=27436

Uniprot URL

https://www.uniprot.org/uniprot/Q9HC35

AA Sequence

GTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKAKGAEIKTTNEVVLAVEFHPTDANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGDVLTGDSGGVMLIWSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGKDRKIILWDHDLNPEREIEVPDQYGTIRAVAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPB41 Rabbit Polyclonal Antibody (BF488)
orb2459645 100 µL

EPB41 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Anti-Phospho-ATF4 (S219) Antibody
P00371 100 µL

Anti-Phospho-ATF4 (S219) Antibody

Sign In for Pricing
View Details
GAPDH (0411) Alexa Fluor® 594
sc-47724 AF594 200 µg/mL

GAPDH (0411) Alexa Fluor® 594

Sign In for Pricing
View Details
CD83 (CD83 Molecule, BL11, HB15) (PE)
244425-PE 100 µL

CD83 (CD83 Molecule, BL11, HB15) (PE)

Sign In for Pricing
View Details
Alexa Fluor® 647 anti-TMEM119 (Extracellular)
GT19549 100 µg

Alexa Fluor® 647 anti-TMEM119 (Extracellular)

Sign In for Pricing
View Details
CDCA7L Rabbit Polyclonal Antibody (HRP)
orb2101886 100 µL

CDCA7L Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details