Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYCP2 Rabbit pAb (APR22684N)

Product Specifications

Background

The synaptonemal complex is a proteinaceous structure that links homologous chromosomes during the prophase of meiosis. The protein encoded by this gene is a major component of the synaptonemal complex and may bind DNA at scaffold attachment regions. The encoded protein requires synaptonemal complex protein 3, but not 1, for inclusion in the synaptonemal complex.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SYCP2 Rabbit pAb (APR22677N8) .

Synonyms

SYCP2; SCP-2; SCP2

Gene ID

10388

UniProt

Q9BX26

Cellular Locus

Chromosome, Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 175kDa Observed MW: 176kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10388

Uniprot URL

https://www.uniprot.org/uniprot/Q9BX26

AA Sequence

EIESPHINENYIQSKREESHLASSLSKSSEGREKTWFDMPCDATHVSGPTQHLSRKRIYIEDNLSNSNEVEMEEKGERRANLLPKKLCKIEDADHHIHKMSESVSSLSTNDFSIPWETWQNEFAGIEMTYETYERLNSEFKRRNNIRHKMLSYFTTQSWKTAQQHLRTMNHQSQDSRIKKLDKFQFIIIEELENFEKDSQSLKDLEKEFVDFWEKIFQKFSAYQKSEQQRLHLLKTSLAKSVFCNTDSEETVFTSEMCLMKEDMKVLQDRLLKDMLEEELLNVRRELMSVFMSHERNANV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AF647 Anti-Mouse CD40 Antibody
RD20448F-01 50 Tests

AF647 Anti-Mouse CD40 Antibody

Sign In for Pricing
View Details
AF647 Anti-Mouse CD40 Antibody
RD20448F-02 100 Tests

AF647 Anti-Mouse CD40 Antibody

Sign In for Pricing
View Details
AF647 Anti-Mouse CD40 Antibody
RD20448F-03 2x 100 Tests

AF647 Anti-Mouse CD40 Antibody

Sign In for Pricing
View Details
MS4A7 (4SPAN2, CD20L4, CFFM4, Membrane-spanning 4-domains Subfamily A Member 7, CD20 Antigen-like 4, CD20/FC-epsilon-RI-beta Family Member 4, Four-span Transmembrane Protein 2, MGC22368, MS4A8) (MaxLight 650)
129913-ML650 100 µL

MS4A7 (4SPAN2, CD20L4, CFFM4, Membrane-spanning 4-domains Subfamily A Member 7, CD20 Antigen-like 4, CD20/FC-epsilon-RI-beta Family Member 4, Four-span Transmembrane Protein 2, MGC22368, MS4A8) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) PHNC Polyclonal Antibody
MBS7189269 Inquire

Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) PHNC Polyclonal Antibody

Sign In for Pricing
View Details
AFAF (EQTN) (NM_020641) Human Tagged ORF Clone Lentiviral Particle
RC220650L3V 200 µL

AFAF (EQTN) (NM_020641) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details