Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPA3 Rabbit pAb (APR20615N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RPA3 Rabbit pAb (APR20615N) .

Synonyms

RPA3; REPA3; RP-A p14; RP-Ap14

Gene ID

6119

UniProt

P35244

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa Observed MW: 19kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6119

Uniprot URL

https://www.uniprot.org/uniprot/P35244

AA Sequence

DLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SREBP-1 (Sterol Regulatory Element-Binding Protein 1, SREBP-1, Class D basic Helix-Loop-Helix Protein 1, bHLHd1, Sterol Regulatory Element-Binding Transcription Factor 1, Processed sterol Regulatory Element-Binding Protein 1, SREBF1, BHLHD1, SREBP1) discontinued
226023-01 50 µL

SREBP-1 (Sterol Regulatory Element-Binding Protein 1, SREBP-1, Class D basic Helix-Loop-Helix Protein 1, bHLHd1, Sterol Regulatory Element-Binding Transcription Factor 1, Processed sterol Regulatory Element-Binding Protein 1, SREBF1, BHLHD1, SREBP1) discontinued

Sign In for Pricing
View Details
SREBP-1 (Sterol Regulatory Element-Binding Protein 1, SREBP-1, Class D basic Helix-Loop-Helix Protein 1, bHLHd1, Sterol Regulatory Element-Binding Transcription Factor 1, Processed sterol Regulatory Element-Binding Protein 1, SREBF1, BHLHD1, SREBP1) discontinued
226023-02 100 µL

SREBP-1 (Sterol Regulatory Element-Binding Protein 1, SREBP-1, Class D basic Helix-Loop-Helix Protein 1, bHLHd1, Sterol Regulatory Element-Binding Transcription Factor 1, Processed sterol Regulatory Element-Binding Protein 1, SREBF1, BHLHD1, SREBP1) discontinued

Sign In for Pricing
View Details
Recombinant Bacillus anthracis D-alanine--poly (phosphoribitol) ligase subunit 2
MBS1235344-01 0.02 mg (E-Coli)

Recombinant Bacillus anthracis D-alanine--poly (phosphoribitol) ligase subunit 2

Sign In for Pricing
View Details
Recombinant Bacillus anthracis D-alanine--poly (phosphoribitol) ligase subunit 2
MBS1235344-02 0.1 mg (E-Coli)

Recombinant Bacillus anthracis D-alanine--poly (phosphoribitol) ligase subunit 2

Sign In for Pricing
View Details
Recombinant Bacillus anthracis D-alanine--poly (phosphoribitol) ligase subunit 2
MBS1235344-03 0.02 mg (Yeast)

Recombinant Bacillus anthracis D-alanine--poly (phosphoribitol) ligase subunit 2

Sign In for Pricing
View Details
Recombinant Bacillus anthracis D-alanine--poly (phosphoribitol) ligase subunit 2
MBS1235344-04 0.1 mg (Yeast)

Recombinant Bacillus anthracis D-alanine--poly (phosphoribitol) ligase subunit 2

Sign In for Pricing
View Details