Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPP5 Rabbit pAb (APR20440N)

Product Specifications

Background

This gene encodes a member of the p55-like subfamily of the membrane-associated guanylate kinase (MAGUK) gene superfamily. The encoded protein participates in the polarization of differentiating cells, has been shown to regulate myelinating Schwann cells (PMID: 20237282), and is one of the components of the Crumbs complex in the retina. Mice which express lower levels of the orthologous protein have retinal degeneration and impaired vision (PMID: 22114289) . Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MPP5 Rabbit pAb (APR20440N) .

Synonyms

MPP5; PALS1; Mpp5

Gene ID

64398

UniProt

Q8N3R9

Cellular Locus

Cell junction, Cell membrane, Endomembrane system, Peripheral membrane protein, tight junction

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 73kDa/77kDa Observed MW: 77kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=64398

Uniprot URL

https://www.uniprot.org/uniprot/Q8N3R9

AA Sequence

GDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMKQTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm7173 (NM_001099307) Mouse Tagged Lenti ORF Clone
MR222395L3 10 µg

Gm7173 (NM_001099307) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GRF9 Polyclonal Antibody
MBS9006128 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GRF9 Polyclonal Antibody

Sign In for Pricing
View Details
MAP2K1 Polyclonal Antibody
E-AB-70207-01 60 µL

MAP2K1 Polyclonal Antibody

Sign In for Pricing
View Details
MAP2K1 Polyclonal Antibody
E-AB-70207-02 120 µL

MAP2K1 Polyclonal Antibody

Sign In for Pricing
View Details
MAP2K1 Polyclonal Antibody
E-AB-70207-03 200 µL

MAP2K1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Ena/VASP-like protein (Evl), partial
MBS967242-01 0.02 mg (E-Coli)

Recombinant Mouse Ena/VASP-like protein (Evl), partial

Sign In for Pricing
View Details