Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM26 Rabbit pAb (APR19716N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RBM26 Rabbit pAb (APR19716N) .

Synonyms

RBM26; ARRS2; C13orf10; PPP1R132; PRO1777; SE70-2; ZC3H17

Gene ID

64062

UniProt

Q5T8P6

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa/60kDa/62kDa/110kDa/111kDa/113kDa Observed MW: 113kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=64062

Uniprot URL

https://www.uniprot.org/uniprot/Q5T8P6

AA Sequence

TQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRLNHSPPQSSSRYRENRS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Phosphorylated Activated C Kinase Receptor 1 ELISA Kit
MBS7254752-01 48 Well

Human Phosphorylated Activated C Kinase Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Human Phosphorylated Activated C Kinase Receptor 1 ELISA Kit
MBS7254752-02 96 Well

Human Phosphorylated Activated C Kinase Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Human Phosphorylated Activated C Kinase Receptor 1 ELISA Kit
MBS7254752-03 5x 96 Well

Human Phosphorylated Activated C Kinase Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Human Phosphorylated Activated C Kinase Receptor 1 ELISA Kit
MBS7254752-04 10x 96 Well

Human Phosphorylated Activated C Kinase Receptor 1 ELISA Kit

Sign In for Pricing
View Details
RPL5 Peptide
DF6730-BP 1 mg

RPL5 Peptide

Sign In for Pricing
View Details
Mouse Syntaxin 1A, Brain (STX1A) ELISA Kit
abx571066 96 Well

Mouse Syntaxin 1A, Brain (STX1A) ELISA Kit

Sign In for Pricing
View Details