Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C-Myc Rabbit pAb (APR19686N)

Product Specifications

Background

The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality c-Myc Rabbit pAb (APR19686N) .

Synonyms

MRTL; MYCC; bHLHe39; c-Myc; MYC

Gene ID

4609

UniProt

P01106

Cellular Locus

Nucleus, nucleolus, nucleoplasm

Applications

WB (unknow, Human Bladder Cancer, Mus musculus, Homo sapiens, Gallus gallus, Sus scrofa) ChIP (Homo sapiens, Mus musculus) Co-IP (Homo sapiens, Mus musculus, Homo sapiens, Gallus gallus) IP (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 48kDa/50kDa Observed MW: 60KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4609

Uniprot URL

https://www.uniprot.org/uniprot/P01106

AA Sequence

MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG5 (Autophagy Marker) (ATG5/2101), CF568 conjugate, 0.1mg/mL
BNC682101-500 1x 500 µL

ATG5 (Autophagy Marker) (ATG5/2101), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(R)-3-Amino-4-(2,4,5-trifluorophenyl)butanoic Acid Hydrochloride
TRC-A630750-50MG 50 mg

(R)-3-Amino-4-(2,4,5-trifluorophenyl)butanoic Acid Hydrochloride

Sign In for Pricing
View Details
HypoGel® 400 REM
SP400110150180.100G 100 g

HypoGel® 400 REM

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS700066 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
CD8 (C8/468), CF640R conjugate, 0.1mg/mL
BNC400468-500 1x 500 µL

CD8 (C8/468), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lymphoid tissue
CS629639 5x 5 µm

Frozen Tissue Sections, Lymphoid tissue

Sign In for Pricing
View Details