Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK7 Rabbit pAb (APR19559N)

Product Specifications

Background

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK) . It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDK7 Rabbit pAb (APR19556N2) .

Synonyms

CDK7; CAK; CAK1; CDKN7; HCAK; MO15; STK1; p39MO15

Gene ID

1022

UniProt

P50613

Cellular Locus

Cytoplasm, Nucleus, perinuclear region

Applications

WB (Human colon cancer cell, Homo sapiens) IHC (Human colon cancer cell)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa Observed MW: 40KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1022

Uniprot URL

https://www.uniprot.org/uniprot/P50613

AA Sequence

PFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD24 (CD24 Antigen, GPI linked Surface Mucin, Heat Stable Antigen, HSA, Nectadrin, Signal Transducer CD24, Small Cell Lung Carcinoma Cluster 4 Antigen)
C2275-05K1-01 100 µg

CD24 (CD24 Antigen, GPI linked Surface Mucin, Heat Stable Antigen, HSA, Nectadrin, Signal Transducer CD24, Small Cell Lung Carcinoma Cluster 4 Antigen)

Ask
View Details
CD24 (CD24 Antigen, GPI linked Surface Mucin, Heat Stable Antigen, HSA, Nectadrin, Signal Transducer CD24, Small Cell Lung Carcinoma Cluster 4 Antigen)
C2275-05K1-02 200 µg

CD24 (CD24 Antigen, GPI linked Surface Mucin, Heat Stable Antigen, HSA, Nectadrin, Signal Transducer CD24, Small Cell Lung Carcinoma Cluster 4 Antigen)

Ask
View Details
Mouse Monoclonal ILT2/CD85j/LILRB1 Antibody (292305) [DyLight 350]
FAB20171D 0.1 mL

Mouse Monoclonal ILT2/CD85j/LILRB1 Antibody (292305) [DyLight 350]

Ask
View Details
Msh3 (NM_010829) Mouse Tagged ORF Clone Lentiviral Particle
MR218117L3V 200 µL

Msh3 (NM_010829) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
NSUN5 (NM_001168348) Human Tagged ORF Clone Lentiviral Particle
RC229982L3V 200 µL

NSUN5 (NM_001168348) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
3-O-Methyl Norbuprenorphine discontinued
426531-01 1 mg

3-O-Methyl Norbuprenorphine discontinued

Ask
View Details