Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MR1 Peptide - N-terminal region

MR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HLALS

UniProt

Q95460

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MR1 Rabbit Polyclonal Antibody (orb589180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001181928.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-GST-tag Antibody Antibody (AcalephFluor532)
orb2987050-01 30 µL

Mouse Anti-GST-tag Antibody Antibody (AcalephFluor532)

Sign In for Pricing
View Details
Mouse Anti-GST-tag Antibody Antibody (AcalephFluor532)
orb2987050-02 100 µL

Mouse Anti-GST-tag Antibody Antibody (AcalephFluor532)

Sign In for Pricing
View Details
Mouse Anti-GST-tag Antibody Antibody (AcalephFluor532)
orb2987050-03 200 µL

Mouse Anti-GST-tag Antibody Antibody (AcalephFluor532)

Sign In for Pricing
View Details
C16orf91 Human qPCR Primer Pair (NM_001010878)
HP202062 200 Reactions

C16orf91 Human qPCR Primer Pair (NM_001010878)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Multiple antibiotic resistance protein marA (marA)
MBS1170433-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O157:H7 Multiple antibiotic resistance protein marA (marA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Multiple antibiotic resistance protein marA (marA)
MBS1170433-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O157:H7 Multiple antibiotic resistance protein marA (marA)

Sign In for Pricing
View Details