Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZIP8 Rabbit pAb (APR18020N)

Product Specifications

Background

This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import of zinc at the onset of inflammation. It is also thought to be the primary transporter of the toxic cation cadmium, which is found in cigarette smoke. Multiple transcript variants encoding different isoforms have been found for this gene. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZIP8 Rabbit pAb (APR18020N) .

Synonyms

SLC39A8; BIGM103; CDG2N; LZT-Hs6; PP3105; ZIP8

Gene ID

64116

UniProt

Q9C0K1

Cellular Locus

Membrane, Multi-pass membrane protein

Applications

WB (Bos taurus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 43kDa/48kDa/49kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=64116

Uniprot URL

https://www.uniprot.org/uniprot/Q9C0K1

AA Sequence

QLIPEAFGFDPKVDSYVEKAVAVFGGFYLLFFFERMLKMLLKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCLKGPKLSEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant DNAI3 Antibody
RN-14551-01 50 μL

Recombinant DNAI3 Antibody

Sign In for Pricing
View Details
Recombinant DNAI3 Antibody
RN-14551-02 100 µL

Recombinant DNAI3 Antibody

Sign In for Pricing
View Details
Recombinant DNAI3 Antibody
RN-14551-03 1 mL

Recombinant DNAI3 Antibody

Sign In for Pricing
View Details
BMP4 (NM_130851) Human Recombinant Protein
TP761239 50 µg

BMP4 (NM_130851) Human Recombinant Protein

Sign In for Pricing
View Details
Mycoplasma TaqMan PCR Kit
TM33150 100 Reactions

Mycoplasma TaqMan PCR Kit

Sign In for Pricing
View Details
Drebrin 1 (DBN1) (DBN1/2879), CF405S conjugate, 0.1mg/mL
BNC042879-500 1x 500 µL

Drebrin 1 (DBN1) (DBN1/2879), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details