Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA0101 Rabbit pAb (APR17981N)

Product Specifications

Background

PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KIAA0101 Rabbit pAb (APR17974N7) .

Synonyms

PCLAF; KIAA0101; L5; NS5ATP9; OEATC; OEATC-1; OEATC1; PAF; PAF15; p15 (PAF) ; p15/PAF; p15PAF

Gene ID

9768

UniProt

Q15004

Cellular Locus

Cytoplasm, Nucleus, perinuclear region

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 7kDa/11kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9768

Uniprot URL

https://www.uniprot.org/uniprot/Q15004

AA Sequence

MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTSA (NM_000308) Human Over-expression Lysate
LY424807 100 µg

CTSA (NM_000308) Human Over-expression Lysate

Sign In for Pricing
View Details
WDR77 Rabbit Polyclonal Antibody
HA500456 100 µL

WDR77 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAB21L4 (NM_001085437) Human Over-expression Lysate
LY421299 100 µg

MAB21L4 (NM_001085437) Human Over-expression Lysate

Sign In for Pricing
View Details
Human MAB21L3 activation kit by CRISPRa
GA114969 1 Kit

Human MAB21L3 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant TPX2 Antibody
RC-5952-01 50 μL

Recombinant TPX2 Antibody

Sign In for Pricing
View Details
Recombinant TPX2 Antibody
RC-5952-02 100 µL

Recombinant TPX2 Antibody

Sign In for Pricing
View Details