What is the catalog number for TLR1 Rabbit pAb (APR17634N)?

The catalog number for TLR1 Rabbit pAb (APR17634N) is APR17634N.

What sizes are available for TLR1 Rabbit pAb (APR17634N)?

TLR1 Rabbit pAb (APR17634N) is available in the following size(s): 50 µL, 100 µL, 200 µL.

How many pack sizes does TLR1 Rabbit pAb (APR17634N) come in?

TLR1 Rabbit pAb (APR17634N) is available in 3 different pack sizes.

Is TLR1 Rabbit pAb (APR17634N) in stock?

TLR1 Rabbit pAb (APR17634N) is currently made to order / not held in immediate stock. Contact us for lead time.

TLR1 Rabbit pAb (APR17634N)

Product Specifications

Background

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is ubiquitously expressed, and at higher levels than other TLR genes. Different length transcripts presumably resulting from use of alternative polyadenylation site, and/or from alternative splicing, have been noted for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TLR1 Rabbit pAb (APR17634N) .

Synonyms

TLR1; CD281; TIL; TIL. LPRS5; rsc786; TIL.LPRS5

Gene ID

7096

UniProt

Q15399

Cellular Locus

Cell membrane, Cytoplasmic vesicle, Single-pass type I membrane protein, phagosome membrane

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 90kDa Observed MW: 90KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7096

Uniprot URL

https://www.uniprot.org/uniprot/Q15399

AA Sequence

DRSKNGLIHVPKDLSQKTTILNISQNYISELWTSDILSLSKLRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLDLSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKEDPEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKLQTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDFR