Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL4 Antibody - middle region : Biotin (ARP54330_P050-Biotin)

Product Specifications

Gene Name

Interleukin 4

Gene Aliases

BSF1, IL-4, BCGF1, BSF-1, BCGF-1

Gene ID

3565

Swiss Prot

P05112

Accession Number

NP_000580

Host

Rabbit

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IL4

Target

IL4 participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.The protein encoded by this gene is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine. This gene, IL3, IL5, IL13, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL13. This gene, IL13 and IL5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Partner Proteins

IL13; IL4; PIK3CD; IL2RG; IL13RA2; CD53; IL4R; A2M

Clonality

Polyclonal

Conjugation

Biotin

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Concentration

0.5 mg/ml

Homology

Human: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

15kDa

References & Citations

Pachkoria, K., (2008) J. Hepatol. 49 (1), 107-114

Shipping Conditions

Wet Ice

Protein Length

153

NCBI Gene Symbol

IL4

NCBI GB Accession Number

IL4

Host or Source

Rabbit

Protein Name

Interleukin-4

Nucleotide Accession Number

NM_000589

Peptide Sequence

LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glass Beads (30-50µm)
18901-100 100 g

Glass Beads (30-50µm)

Sign In for Pricing
View Details
(E)-9-Octadecenethioic Acid Sodium Salt
TRC-O766330-100MG 100 mg

(E)-9-Octadecenethioic Acid Sodium Salt

Sign In for Pricing
View Details
NCOA6 (Nuclear Receptor Coactivator 6, Activating Signal Cointegrator 2, ASC-2, Amplified in Breast Cancer Protein 3, Cancer-amplified Transcriptional Coactivator ASC-2, Nuclear Receptor Coactivator RAP250, NRC RAP250, Nuclear Receptor-activating Protein,
MBS6159018-01 0.1 mL

NCOA6 (Nuclear Receptor Coactivator 6, Activating Signal Cointegrator 2, ASC-2, Amplified in Breast Cancer Protein 3, Cancer-amplified Transcriptional Coactivator ASC-2, Nuclear Receptor Coactivator RAP250, NRC RAP250, Nuclear Receptor-activating Protein,

Sign In for Pricing
View Details
NCOA6 (Nuclear Receptor Coactivator 6, Activating Signal Cointegrator 2, ASC-2, Amplified in Breast Cancer Protein 3, Cancer-amplified Transcriptional Coactivator ASC-2, Nuclear Receptor Coactivator RAP250, NRC RAP250, Nuclear Receptor-activating Protein,
MBS6159018-02 5x 0.1 mL

NCOA6 (Nuclear Receptor Coactivator 6, Activating Signal Cointegrator 2, ASC-2, Amplified in Breast Cancer Protein 3, Cancer-amplified Transcriptional Coactivator ASC-2, Nuclear Receptor Coactivator RAP250, NRC RAP250, Nuclear Receptor-activating Protein,

Sign In for Pricing
View Details
Human Taste receptor type 2 member 19 (TAS2R19) ELISA Kit
KTE60491-01 48 Tests

Human Taste receptor type 2 member 19 (TAS2R19) ELISA Kit

Sign In for Pricing
View Details
Human Taste receptor type 2 member 19 (TAS2R19) ELISA Kit
KTE60491-02 96 Tests

Human Taste receptor type 2 member 19 (TAS2R19) ELISA Kit

Sign In for Pricing
View Details