Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHH, Human

Sonic Hedgehog (SHH) Protein is a secretory glycoprotein of the Hedgehog family that can self-cleave to form N-SHH. SHH Protein activates Smo by binding to Frizzled and LRP6, inhibits GSK-3β to stabilize β-catenin, and activates FOXM1. SHH Protein also promotes NO release and shortens myocardial APD by phosphorylating eNOS through PI3K/Akt. SHH Protein can promote the maturation of sweat gland cells in three-dimensional culture and play a cardioprotective role in the pig ischemia-reperfusion model[1][2]. SHH Protein, Human is a recombinant human SHH protein expressed in E. coli with tag-free.

Product Specifications

Product Name Alternative

SHH Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/shh-protein-human.html

Purity

98.0

Smiles

CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Molecular Formula

6469 (Gene_ID) Q15465 (C24-G197) (Accession)

Molecular Weight

Approximately 23-25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Wang XZ, et al. Sonic hedgehog (Shh) and CC chemokine ligand 2 signaling pathways in asthma. J Chin Med Assoc. 2019;82 (5) :343-350.|[2]Seo H, et al. Upstream Enhancer Elements of Shh Regulate Oral and Dental Patterning. J Dent Res. 2018;97 (9) :1055-1063.|[3]Huang Z, et al. Shh promotes sweat gland cell maturation in three-dimensional culture. Cell Tissue Bank. 2016 Jun;17 (2) :317-25.|[4]Ghaleh B, et al. Cardioprotective effect of sonic hedgehog ligand in pig models of ischemia reperfusion. Theranostics. 2020 Mar 4;10 (9) :4006-4016.|[5]Spinella-Jaegle S, et al. Sonic hedgehog increases the commitment of pluripotent mesenchymal cells into the osteoblastic lineage and abolishes adipocytic differentiation. J Cell Sci. 2001 Jun;114 (Pt 11) :2085-94.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B4galnt4 (NM_177897) Mouse Tagged ORF Clone
MR220287 10 µg

B4galnt4 (NM_177897) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
HSCB Antibody
16-347 100 µL

HSCB Antibody

Sign In for Pricing
View Details
Ampicillin (Sodium), USP Grade
A-301-25-10g 10 g

Ampicillin (Sodium), USP Grade

Sign In for Pricing
View Details
Dopamine Receptor D1 Rabbit Polyclonal Antibody
orb1742671 100 µL

Dopamine Receptor D1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPL8P2 3'UTR Luciferase Stable Cell Line
TU020625 1.0 mL

RPL8P2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Bovine Copper chaperone for superoxide dismutase (CCS) ELISA Kit
GTR10368694 96 Well

Bovine Copper chaperone for superoxide dismutase (CCS) ELISA Kit

Sign In for Pricing
View Details