Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLRG1, Human (His-SUMO)

KLRG1 Protein exerts inhibitory effects on NK cells and T-cells by binding to their non-MHC ligands, potentially recognizing "missing self" through conserved sites on classical cadherins like E-cadherin/CDH1, N-cadherin/CDH2, and R-cadherin/CDH4. Existing as a monomer and homodimer connected by disulfide bonds, KLRG1 interacts with PTPN11 and INPP5D via its ITIM motif, suggesting involvement in signal transduction pathways. KLRG1 Protein, Human (His-SUMO) is the recombinant human-derived KLRG1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

KLRG1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/klrg1-protein-human-his-sumo.html

Purity

95.0

Smiles

LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF

Molecular Formula

10219 (Gene_ID) Q96E93 (L60-F195) (Accession)

Molecular Weight

Approximately 31.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human HNF1b (Hepatocyte Nuclear Factor 1 Beta) Microsample ELISA Kit
ELK4646MS-01 48 Tests

Human HNF1b (Hepatocyte Nuclear Factor 1 Beta) Microsample ELISA Kit

Ask
View Details
Human HNF1b (Hepatocyte Nuclear Factor 1 Beta) Microsample ELISA Kit
ELK4646MS-02 96 Tests

Human HNF1b (Hepatocyte Nuclear Factor 1 Beta) Microsample ELISA Kit

Ask
View Details
Human HNF1b (Hepatocyte Nuclear Factor 1 Beta) Microsample ELISA Kit
ELK4646MS-03 5x 96 Tests

Human HNF1b (Hepatocyte Nuclear Factor 1 Beta) Microsample ELISA Kit

Ask
View Details
Rabbit anti-Escherichia coli (strain 8739/DSM 1576/Crooks) CSRA Polyclonal Antibody
MBS7184097 Inquire

Rabbit anti-Escherichia coli (strain 8739/DSM 1576/Crooks) CSRA Polyclonal Antibody

Ask
View Details
Interleukin 1 alpha, Recombinant, Porcine (Interleukin-1 alpha, IL-1 alpha, IL-1a, IL1A) discontinued
I7663-03P 10 µg

Interleukin 1 alpha, Recombinant, Porcine (Interleukin-1 alpha, IL-1 alpha, IL-1a, IL1A) discontinued

Ask
View Details
CD79a Antibody
E51A09991 100 µL

CD79a Antibody

Ask
View Details