Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLRG1, Human (His-SUMO)

KLRG1 Protein exerts inhibitory effects on NK cells and T-cells by binding to their non-MHC ligands, potentially recognizing "missing self" through conserved sites on classical cadherins like E-cadherin/CDH1, N-cadherin/CDH2, and R-cadherin/CDH4. Existing as a monomer and homodimer connected by disulfide bonds, KLRG1 interacts with PTPN11 and INPP5D via its ITIM motif, suggesting involvement in signal transduction pathways. KLRG1 Protein, Human (His-SUMO) is the recombinant human-derived KLRG1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

KLRG1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/klrg1-protein-human-his-sumo.html

Purity

95.0

Smiles

LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF

Molecular Formula

10219 (Gene_ID) Q96E93 (L60-F195) (Accession)

Molecular Weight

Approximately 31.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SYNRG (NM_001163547) Human Tagged Lenti ORF Clone
RC229063L4 10 µg

SYNRG (NM_001163547) Human Tagged Lenti ORF Clone

Ask
View Details
DS-1001b (DS 1001)
C18240 25 mg

DS-1001b (DS 1001)

Ask
View Details
PRRX1 Human qPCR Primer Pair (NM_022716)
HP231025 200 Reactions

PRRX1 Human qPCR Primer Pair (NM_022716)

Ask
View Details
ISM1 rabbit pAb
UB-GEN-9668 100 µL

ISM1 rabbit pAb

Ask
View Details
KLF11, NT (Krueppel-like Factor 11, Transforming Growth Factor-beta-inducible Early Growth Response Protein 2, TGFB-inducible Early Growth Response Protein 2, TIEG-2, TIEG2, FKLF)
K1891-54A 200 µL

KLF11, NT (Krueppel-like Factor 11, Transforming Growth Factor-beta-inducible Early Growth Response Protein 2, TGFB-inducible Early Growth Response Protein 2, TIEG-2, TIEG2, FKLF)

Ask
View Details