Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-C/CD323, Human (HEK293)

The JAM-C/CD323 protein is a junctional adhesion protein that regulates various cellular processes by interacting with JAM2 and JAM3. It is essential for the homing of hematopoietic cells in the bone marrow, promotes leukocyte migration, and participates in spermatogenesis by anchoring germ cells. JAM-C/CD323 Protein, Human (HEK293) is the recombinant human-derived JAM-C/CD323 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

JAM-C/CD323 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-c-cd323-protein-human-hek293.html

Purity

95.00

Smiles

VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLN

Molecular Formula

83700 (Gene_ID) Q9BX67 (V32-N241) (Accession)

Molecular Weight

Approximately 26-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human LRIG3 shRNA (UAS) - Lentiviral human LRIG3 shRNA (UAS, iRFP) (100)
GTR15339186 1 Vial

Lentiviral human LRIG3 shRNA (UAS) - Lentiviral human LRIG3 shRNA (UAS, iRFP) (100)

Ask
View Details
C14orf86 CRISPR All-in-one AAV vector set (with saCas9)(Human)
53624151 3x 1.0 µg DNA

C14orf86 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Ask
View Details
MAPK9, Recombinant, Human, aa1-424, His-SUMO-Tag (Mitogen-activated Protein Kinase 9)
374149-01 20 µg

MAPK9, Recombinant, Human, aa1-424, His-SUMO-Tag (Mitogen-activated Protein Kinase 9)

Ask
View Details
MAPK9, Recombinant, Human, aa1-424, His-SUMO-Tag (Mitogen-activated Protein Kinase 9)
374149-02 100 µg

MAPK9, Recombinant, Human, aa1-424, His-SUMO-Tag (Mitogen-activated Protein Kinase 9)

Ask
View Details
MAPK9, Recombinant, Human, aa1-424, His-SUMO-Tag (Mitogen-activated Protein Kinase 9)
374149-03 1 mg

MAPK9, Recombinant, Human, aa1-424, His-SUMO-Tag (Mitogen-activated Protein Kinase 9)

Ask
View Details