Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tubulin beta-5 chain (Tubb5)

Product Specifications

Abbreviation

Recombinant Mouse Tubb5 protein

Gene Name

Tubb5

UniProt

P99024

Expression Region

1-444aa

Organism

Mus musculus (Mouse)

Target Sequence

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow by the addition of GTP-tubulin dimers to the microtubule end, where a stabilizing cap forms. Below the cap, tubulin dimers are in GDP-bound state, owing to GTPase activity of alpha-tubulin.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

56.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

JPH1 Rabbit Polyclonal Antibody
TA306681 100 µg

JPH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AGBL5-IT1 ORF Vector (Human) (pORF)
ORF015373 1.0 µg DNA

AGBL5-IT1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human HCRTR2 (Orexin receptor type 2) ELISA Kit
EH14683 96 Tests

Human HCRTR2 (Orexin receptor type 2) ELISA Kit

Sign In for Pricing
View Details
C9orf72 (NM_018325) Human Tagged ORF Clone Lentiviral Particle
RC209700L2V 200 µL

C9orf72 (NM_018325) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
4- (4-Nitrophenyl) -4,5,6,7-tetrahydrothieno-[3,2-c]pyridine
sc-314697A 5 mg

4- (4-Nitrophenyl) -4,5,6,7-tetrahydrothieno-[3,2-c]pyridine

Sign In for Pricing
View Details
Zfp133 AAV siRNA Pooled Vector
50851166 1.0 µg

Zfp133 AAV siRNA Pooled Vector

Sign In for Pricing
View Details