Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein OPG190 (OPG190), partial

Product Specifications

Product Name Alternative

Plaque-size/host range protein

Abbreviation

Recombinant Vaccinia virus OPG190 protein, partial

Gene Name

OPG190

UniProt

Q01227

Expression Region

18-279aa

Organism

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Target Sequence

YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EV) to allow virion entry into host cells. Also participates in wrapping mature virions (MV) to form enveloped virions (EV)

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adam11 (NM_001108300) Rat Tagged ORF Clone Lentiviral Particle
RR214527L4V 200 µL

Adam11 (NM_001108300) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CeMMEC1 (hydrochloride)
HY-111445A 1 Each

CeMMEC1 (hydrochloride)

Sign In for Pricing
View Details
Ptpn22 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7613108 1.0 µg DNA

Ptpn22 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Keratin 33B (Keratin-33B, KRT33B, K33B, KRTHA3B, Keratin Type I Cuticular Ha3-II, HA3II, Ha-3II, Hair Keratin Type I Ha3-II, HHA3-II, HKA3B, KRTHA3A) (MaxLight 650)
128773-ML650 100 µL

Keratin 33B (Keratin-33B, KRT33B, K33B, KRTHA3B, Keratin Type I Cuticular Ha3-II, HA3II, Ha-3II, Hair Keratin Type I Ha3-II, HHA3-II, HKA3B, KRTHA3A) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Gluconobacter oxydans Large-conductance mechanosensitive channel (mscL), partial
MBS7082201 Inquire

Recombinant Gluconobacter oxydans Large-conductance mechanosensitive channel (mscL), partial

Sign In for Pricing
View Details
TAZ Rabbit pAb (APR28035N)
APR28035N-01 50 µL

TAZ Rabbit pAb (APR28035N)

Sign In for Pricing
View Details