Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAZ Rabbit pAb (APR28035N)

Product Specifications

Background

Transcriptional coactivator which acts as a downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. WWTR1 enhances PAX8 and NKX2-1/TTF1-dependent gene activation. In conjunction with YAP1, involved in the regulation of TGFB1-dependent SMAD2 and SMAD3 nuclear accumulation. Plays a key role in coupling SMADs to the transcriptional machinery such as the mediator complex. Regulates embryonic stem-cell self-renewal, promotes cell proliferation and epithelial-mesenchymal transition.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TAZ Rabbit pAb (APR28035N) .

Synonyms

WW domain-containing transcription regulator protein 1; Transcriptional coactivator with PDZ-binding motif; TAZ; WWTR1

Gene ID

25937

UniProt

Q9GZV5

Cellular Locus

Cytoplasm, Nucleus

Applications

IHC (Homo sapiens, Mus musculus) ChIP (Mus musculus) IF (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 44kDa Observed MW: 55KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=25937

Uniprot URL

https://www.uniprot.org/uniprot/Q9GZV5

AA Sequence

MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQ

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal NMDA R NR1 Subunit Antibody (S308-48) [Alexa Fluor 488]
NBP2-59327AF488 100 µL

Mouse Monoclonal NMDA R NR1 Subunit Antibody (S308-48) [Alexa Fluor 488]

Ask
View Details
Histone H1.2 (HIST1H1C) Rabbit Polyclonal Antibody
AP54998SU-N 200 µL

Histone H1.2 (HIST1H1C) Rabbit Polyclonal Antibody

Ask
View Details
Mouse UCP2 ELISA Kit (Colorimetric)
NBP2-82415 1 Kit

Mouse UCP2 ELISA Kit (Colorimetric)

Ask
View Details
Polygonatum multiflorum (PMA) (Gold, 5nm) discontinued
P4444-45G 1 mL

Polygonatum multiflorum (PMA) (Gold, 5nm) discontinued

Ask
View Details
KIAA1324L Recombinant Protein Antigen
NBP1-94056PEP 0.1 mL

KIAA1324L Recombinant Protein Antigen

Ask
View Details
VTCN1 (V-set Domain Containing T-cell Activation Inhibitor 1, B7H4, B7-H4, B7h.5, B7S1, B7X, FLJ22418, Immune Costimulatory Protein B7-H4, PRO1291, Protein B7S1, RP11-229A19.4, T-cell Costimulatory Molecule B7x, UNQ659, FLJ22418) discontinued
151150 100 µg

VTCN1 (V-set Domain Containing T-cell Activation Inhibitor 1, B7H4, B7-H4, B7h.5, B7S1, B7X, FLJ22418, Immune Costimulatory Protein B7-H4, PRO1291, Protein B7S1, RP11-229A19.4, T-cell Costimulatory Molecule B7x, UNQ659, FLJ22418) discontinued

Ask
View Details