Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pectobacterium cypripedii Gluconate 2-dehydrogenase flavoprotein, partial

Product Specifications

Product Name Alternative

GA 2-DH dehydrogenase subunit

Abbreviation

Recombinant Pectobacterium cypripedii Gluconate 2-dehydrogenase flavoprotein, partial

UniProt

O34214

Expression Region

451-615aa

Organism

Pantoea cypripedii (Pectobacterium cypripedii) (Erwinia cypripedii)

Target Sequence

ADTYNHHISMDAHGAHQSYRANYLDLDPNYKNVYGQPLLRMTFDWQDNDIRMAQFMVGKMRKITEAMNPKMIIGGAKGPGTHFDTTVYQTTHMSGGAIMGEDPKTSAVNRYLQSWDVPNVFVPGASAFPQGLGYNPTGMVAALTYWSAKAIREQYLKNPGPLVQA

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Part of the heterotrimer that catalyzes the conversion of D-gluconate to 2-dehydro-D-gluconate. This subunit functions as the dehydrogenase

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P34 / cdk1 (POH-1), CF568 conjugate, 0.1mg/mL
BNC680853-100 1x 100 µL

P34 / cdk1 (POH-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ugt1a6b Mouse Gene Knockout Kit (CRISPR)
KN518668 1 Kit

Ugt1a6b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human DET1 activation kit by CRISPRa
GA110492 1 Kit

Human DET1 activation kit by CRISPRa

Sign In for Pricing
View Details
FITC Anti-Human CD326/EpCAM Antibody[9C4]
E-AB-F1163C-01 20 Tests

FITC Anti-Human CD326/EpCAM Antibody[9C4]

Sign In for Pricing
View Details
FITC Anti-Human CD326/EpCAM Antibody[9C4]
E-AB-F1163C-02 100 Tests

FITC Anti-Human CD326/EpCAM Antibody[9C4]

Sign In for Pricing
View Details
FITC Anti-Human CD326/EpCAM Antibody[9C4]
E-AB-F1163C-03 2x 100 Tests

FITC Anti-Human CD326/EpCAM Antibody[9C4]

Sign In for Pricing
View Details