Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Gastric inhibitory polypeptide receptor (Gipr), partial

Product Specifications

Product Name Alternative

GIP-R; Glucose-dependent insulinotropic polypeptide receptor

Abbreviation

Recombinant Rat Gipr protein, partial

Gene Name

Gipr

UniProt

P43219

Expression Region

19-135aa

Organism

Rattus norvegicus (Rat)

Target Sequence

RAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQKLILERLQ

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Obesity

Relevance

This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTUD2 HDR Plasmid (m)
sc-432624-HDR 20 µg

OTUD2 HDR Plasmid (m)

Sign In for Pricing
View Details
RAMP1 Rabbit Polyclonal Antibody
E28PN2986 100 µL

RAMP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRL3, CT (PTP4A3, PRL-3, PRL-R, Protein Tyrosine Phosphatase Type IVA, Member 3, Protein-tyrosine Phosphatase 4a3, Protein-tyrosine Phosphatase Of Regenerating Liver 3) (FITC) discontinued
P9109-48C2-FITC 200 µL

PRL3, CT (PTP4A3, PRL-3, PRL-R, Protein Tyrosine Phosphatase Type IVA, Member 3, Protein-tyrosine Phosphatase 4a3, Protein-tyrosine Phosphatase Of Regenerating Liver 3) (FITC) discontinued

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor Receptor Substrate 2 ELISA Kit
MBS010687-01 48 Well

Mouse Fibroblast Growth Factor Receptor Substrate 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor Receptor Substrate 2 ELISA Kit
MBS010687-02 96 Well

Mouse Fibroblast Growth Factor Receptor Substrate 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor Receptor Substrate 2 ELISA Kit
MBS010687-03 5x 96 Well

Mouse Fibroblast Growth Factor Receptor Substrate 2 ELISA Kit

Sign In for Pricing
View Details