Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human StAR-related lipid transfer protein 6 (STARD6)

Product Specifications

Product Name Alternative

START domain-containing protein 6; StARD6

Abbreviation

Recombinant Human STARD6 protein

Gene Name

STARD6

UniProt

P59095

Expression Region

1-220aa

Organism

Homo sapiens (Human)

Target Sequence

MDFKAIAQQTAQEVLGYNRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQTGDRITWDKSLQVYNMVHRIDSDTFICHTITQSFAVGSISPRDFIDLVYIKRYEGNMNIISSKSVDFPEYPPSSNYIRGYNHPCGFVCSPMEENPAYSKLVMFVQTEMRGKLSPSIIEKTMPSNLVNFILNAKDGIKAHRTPSRRGFHHNSHS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

May be involved in the intracellular transport of sterols or other lipids. May bind cholesterol or other sterols.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNAZ Antibody, FITC conjugated
A23448-50UG 50 µg

GNAZ Antibody, FITC conjugated

Sign In for Pricing
View Details
Olr1256 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV635851 1.0 µg DNA

Olr1256 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Human Annexin A8/ANXA8 Protein
PKSH032078-01 10 µg

Recombinant Human Annexin A8/ANXA8 Protein

Sign In for Pricing
View Details
Recombinant Human Annexin A8/ANXA8 Protein
PKSH032078-02 50 µg

Recombinant Human Annexin A8/ANXA8 Protein

Sign In for Pricing
View Details
Lentiviral mouse Calcb shRNA (UAS) - Lentiviral mouse Calcb shRNA (UAS) plasmid
GTR15201847 1 Vial

Lentiviral mouse Calcb shRNA (UAS) - Lentiviral mouse Calcb shRNA (UAS) plasmid

Sign In for Pricing
View Details
VEGFA (Vascular Endothelial Growth Factor A, VEGF, VEGF-A, VPF, Vascular Endothelial Cell Growth Factor A, Vascular Permeability Factor)
365557 200 µL

VEGFA (Vascular Endothelial Growth Factor A, VEGF, VEGF-A, VPF, Vascular Endothelial Cell Growth Factor A, Vascular Permeability Factor)

Sign In for Pricing
View Details