Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Small ribosomal subunit protein bS16 (rpsP)

Product Specifications

Abbreviation

Recombinant Staphylococcus aureus rpsP protein

Gene Name

RpsP

UniProt

Q2FHK0

Expression Region

1-91aa

Organism

Staphylococcus aureus (strain USA300)

Target Sequence

MAVKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIKVDEALALKWLNDGAKPTDTVHNILSKEGIMKKFDEQKKAK

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RPAIN activation kit by CRISPRa
GA113465 1 Kit

Human RPAIN activation kit by CRISPRa

Sign In for Pricing
View Details
TBCEL (NM_001130047) Human Recombinant Protein
TP325691 20 µg

TBCEL (NM_001130047) Human Recombinant Protein

Sign In for Pricing
View Details
Rab6b Mouse Gene Knockout Kit (CRISPR)
KN514382 1 Kit

Rab6b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Melanoma gp100 Recombinant Rabbit Monoclonal Antibody [JE42-47]
HA721719 100 µL

Melanoma gp100 Recombinant Rabbit Monoclonal Antibody [JE42-47]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex II,  15nm
GM-16-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex II, 15nm

Sign In for Pricing
View Details
Human DOHH activation kit by CRISPRa
GA113183 1 Kit

Human DOHH activation kit by CRISPRa

Sign In for Pricing
View Details