Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAM-1, Rat (HEK293, His)

DNAM-1 protein is a key player in cell-cell adhesion and lymphocyte signaling, mediating cytotoxicity and lymphokine secretion of CTL and NK cells. As a receptor for NECTIN2, DNAM-1 stimulates T cell proliferation and cytokine production (IL2, IL5, IL10, IL13, and IFNG) upon ligand binding. DNAM-1 Protein, Rat (HEK293, His) is the recombinant rat-derived DNAM-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DNAM-1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dnam-1-protein-rat-hek293-his.html

Purity

97.00

Smiles

EETLWDTTVRLSETMTLECVYPLTDNLTQAEWTKDTGTKKVNIAVYHPNHNMHIDPNYLHRVHFQNATVGFRNMSLSFYNASEADIGIYTCLFHAFPRGSWEKKIKVVQSDSFETTAPLDSYLSAEPGQNVTLSCQLERTWLVQLVIWEKVQPHQVDILASCNLSQGTRYTSKYLRQTWSDCSQESMKSALIIPYAMAADSGLYRCRSEASTGTNKTCVIRLIITDGGTNNHFI

Molecular Formula

307199 (Gene_ID) D3ZS97 (E32-I265) (Accession)

Molecular Weight

Approximately 28 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Protein Unc-13 Homolog A (UNC13A) ELISA Kit
MBS9365286 Inquire

Goat Protein Unc-13 Homolog A (UNC13A) ELISA Kit

Sign In for Pricing
View Details
GCP-2 (CXCL6)
100-028-L500 500 µg

GCP-2 (CXCL6)

Sign In for Pricing
View Details
Optical Bench Kit Big
1110834 1 Each

Optical Bench Kit Big

Sign In for Pricing
View Details
Anti-ASTL Rabbit pAb
GB115383-50 50 μL

Anti-ASTL Rabbit pAb

Sign In for Pricing
View Details
CCDC85C Knockout HGC-27 Polyclonal Cells
ARG43083 1 Million

CCDC85C Knockout HGC-27 Polyclonal Cells

Sign In for Pricing
View Details
Krt9 ORF Vector (Mouse) (pORF)
ORF048849 1.0 µg DNA

Krt9 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details