Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG4 Fc, Human (HEK293)

The IgG4 Fc is the constant region of the immunoglobulin heavy chain, which forms the backbone of antibodies crucial in humoral immunity. B lymphocytes produce glycoprotein antibodies that initiate clonal expansion upon antigen binding. IgG4 Fc Protein, Human (HEK293) is the recombinant human-derived IgG4 Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG4 Fc Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg4-fc-protein-human-hek-293.html

Purity

98.0

Smiles

ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG

Molecular Formula

3503 (Gene_ID) P01861-1 (E99-G326) (Accession)

Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SNW1 Antibody (PCRP-SNW1-1C12) [Alexa Fluor 488]
NBP3-26930AF488 0.1 mL

Mouse Monoclonal SNW1 Antibody (PCRP-SNW1-1C12) [Alexa Fluor 488]

Sign In for Pricing
View Details
PRKAA1 Antibody (Phospho-Thr172) : Biotin (OAAF00003-Biotin)
OAAF00003-100UG-Biotin 100 µg

PRKAA1 Antibody (Phospho-Thr172) : Biotin (OAAF00003-Biotin)

Sign In for Pricing
View Details
Rab11 (RAB11B) Rabbit Polyclonal Antibody
TA380604 100 µL

Rab11 (RAB11B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GDF15 Rabbit Polyclonal Antibody
TA384291 100 µL

GDF15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bovine Alpha-1A adrenergic receptor (ADRA1A) ELISA Kit
RK07965 96 Tests

Bovine Alpha-1A adrenergic receptor (ADRA1A) ELISA Kit

Sign In for Pricing
View Details
METTL23 (NM_001302703) Human Untagged Clone
SC334318 10 µg

METTL23 (NM_001302703) Human Untagged Clone

Sign In for Pricing
View Details