Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-32, Human (HEK293, His)

IL-32 protein is a member of the cytokine family whose expression increases following T cell activation or IL-2-induced NK cell activation. It plays a key role in inducing macrophages to produce TNFα, which contributes to the inflammatory response. IL-32 alphaProtein, Human (HEK293, His) is the recombinant human-derived IL-32 alpha protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-32 alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-32-protein-human-hek293-his.html

Purity

98.00

Smiles

MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK

Molecular Formula

9235 (Gene_ID) P24001-4/NP_001012651 (M1-K131) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF1 Rabbit pAb
E2381413 100 µL

ATF1 Rabbit pAb

Sign In for Pricing
View Details
Calcineurin SubstRate peptide
orb216518-01 1 mg

Calcineurin SubstRate peptide

Sign In for Pricing
View Details
Calcineurin SubstRate peptide
orb216518-02 5 mg

Calcineurin SubstRate peptide

Sign In for Pricing
View Details
Calcineurin SubstRate peptide
orb216518-03 10 mg

Calcineurin SubstRate peptide

Sign In for Pricing
View Details
Recombinant Rat EP300-interacting inhibitor of differentiation 3 (Eid3)
MBS1480822-01 0.02 mg (E-Coli)

Recombinant Rat EP300-interacting inhibitor of differentiation 3 (Eid3)

Sign In for Pricing
View Details
Recombinant Rat EP300-interacting inhibitor of differentiation 3 (Eid3)
MBS1480822-02 0.02 mg (Yeast)

Recombinant Rat EP300-interacting inhibitor of differentiation 3 (Eid3)

Sign In for Pricing
View Details