Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2)

Product Specifications

Product Name Alternative

(GM-CSF) (Colony-stimulating factor) (CSF)

Abbreviation

Recombinant Mouse Csf2 protein

Gene Name

Csf2

UniProt

P01587

Expression Region

18-141aa

Organism

Mus musculus (Mouse)

Target Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.2 kDa

References & Citations

"The genome sequence of the facultative intracellular pathogen Brucella melitensis." DelVecchio V.G., Kapatral V., Redkar R.J., Patra G., Mujer C., Los T., Ivanova N., Anderson I., Bhattacharyya A., Lykidis A., Reznik G., Jablonski L., Larsen N., D'Souza M., Bernal A., Mazur M., Goltsman E., Selkov E. Overbeek R. Proc. Natl. Acad. Sci. U.S.A. 99:443-448 (2002) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Transcription factor E2F6 E2F6 Antibody Picoband®, Dylight550 Conjugate
PA1811-Dylight550 100 µg

Anti-Transcription factor E2F6 E2F6 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
FOXJ3 Peptide - N-terminal region
orb2002576 100 µg

FOXJ3 Peptide - N-terminal region

Sign In for Pricing
View Details
Human Dedicator of cytokinesis protein 1 (DOCK1) Elisa Kit
EK712125 96 Well

Human Dedicator of cytokinesis protein 1 (DOCK1) Elisa Kit

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse MHC II (I-A/I-E) Antibody
RD20065F-01 25 µg

PE/Cyanine7 Anti-Mouse MHC II (I-A/I-E) Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse MHC II (I-A/I-E) Antibody
RD20065F-02 100 µg

PE/Cyanine7 Anti-Mouse MHC II (I-A/I-E) Antibody

Sign In for Pricing
View Details
Alpha 1 Antitrypsin/SERPINA1 Rabbit Polyclonal Antibody (HRP)
orb2622208 100 µg

Alpha 1 Antitrypsin/SERPINA1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details