Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXJ3 Peptide - N-terminal region

FOXJ3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FOXJ3, KIAA1041

UniProt

Q9UPW0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXJ3 Rabbit Polyclonal Antibody (orb588262) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055762

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTNKVTLYNTDQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Protein Phosphatase 1, Regulatory Subunit 3B (PPP1R3B)
RPU58071-01 50 µg

Recombinant Human Protein Phosphatase 1, Regulatory Subunit 3B (PPP1R3B)

Sign In for Pricing
View Details
Recombinant Human Protein Phosphatase 1, Regulatory Subunit 3B (PPP1R3B)
RPU58071-02 100 µg

Recombinant Human Protein Phosphatase 1, Regulatory Subunit 3B (PPP1R3B)

Sign In for Pricing
View Details
Recombinant Human Protein Phosphatase 1, Regulatory Subunit 3B (PPP1R3B)
RPU58071-03 1 mg

Recombinant Human Protein Phosphatase 1, Regulatory Subunit 3B (PPP1R3B)

Sign In for Pricing
View Details
PROTAC c-Met degrader-3
HY-168910 1 Each

PROTAC c-Met degrader-3

Sign In for Pricing
View Details
Setrusumab (Biosimilar Reference Antibody) (SOST)
RA0702-01 100 µg

Setrusumab (Biosimilar Reference Antibody) (SOST)

Sign In for Pricing
View Details
Setrusumab (Biosimilar Reference Antibody) (SOST)
RA0702-02 1 mg

Setrusumab (Biosimilar Reference Antibody) (SOST)

Sign In for Pricing
View Details