Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecO, E.coli (His-SUMO)

RecO protein, a crucial participant in DNA repair and the RecF pathway, operates as a monomer, contributing to the intricate choreography of DNA repair mechanisms and facilitating recombination. Its monomeric form underscores its singular involvement, highlighting its significance in orchestrating cellular responses to DNA damage and recombination. RecO Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RecO protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

RecO Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reco-protein-e-coli-his-sumo.html

Purity

98.0

Smiles

MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTHYE

Molecular Formula

947038 (Gene_ID) P0A7H3 (M1-E242) (Accession)

Molecular Weight

Approximately 43.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

A-Kinase anchor protein 7 isoforms α and β (AKAP7) Mouse ELISA Kit
B1699 96 Tests

A-Kinase anchor protein 7 isoforms α and β (AKAP7) Mouse ELISA Kit

Ask
View Details
Zbtb33 AAV siRNA Pooled Vector
50702164 1.0 µg

Zbtb33 AAV siRNA Pooled Vector

Ask
View Details
Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody
abx306994-01 20 µg

Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody

Ask
View Details
Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody
abx306994-02 50 µg

Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody

Ask
View Details
Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody
abx306994-03 100 µg

Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody

Ask
View Details
Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody
abx306994-04 200 µg

Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody

Ask
View Details