Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus 11 protein E4 (E4)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Human papillomavirus 11 E4 protein

Gene Name

E4

UniProt

P04016

Expression Region

1-90aa

Organism

Human papillomavirus 11

Target Sequence

MADDSALYEKYPLLNLLHTPPHRPPPLQCPPAPRKTACRRRLGSEHVDRPLTTPCVWPTSDPWTVQSTTSSLTITTSTKEGTTVTVQLRL

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Contributes to multiple aspects of the viral life cycle including viral genome amplification, suppression of suprabasal cell differentiation and egress of newly formed virions. Induces host cell cycle arrest at the G2 phase by associating with and preventing the nuclear entry of host CDK1/cyclin B1 complexes. Inhibits cellular DNA replication by preventing loading of host replication licensing proteins MCM2 and MCM7 onto chromatin. Within the cytoplasm, associates with host kinase SRPK1, a splicing factor regulator, and inhibits its activity. Therefore, E4 favors expression of late viral transcripts by inhibiting SRPK1-mediated phosphorylation of host serine-arginine (SR) proteins that have critical roles in mRNA metabolism. Late in the infectious cycle, E4 also acts to diminish the integrity of the keratinocyte by disrupting the keratin cytoskeleton and inducing apoptosis through alteration of mitochondrial function to facilitate egress of the newly formed virions.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.0 kDa

References & Citations

"The nucleotide sequence and genome organization of human papilloma virus type 11." Dartmann K., Schwarz E., Gissmann L., zur Hausen H. Virology 151:124-130 (1986)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttr Antibody, HRP conjugated
A37677-50UG 50 µg

Ttr Antibody, HRP conjugated

Sign In for Pricing
View Details
Recombinant 2019-nCoV S Protein NTD (C-6His)
DRA45-500ug 500 µg

Recombinant 2019-nCoV S Protein NTD (C-6His)

Sign In for Pricing
View Details
Rabbit Anti-Human TAF9 pAb
PA12648-01 50 μL

Rabbit Anti-Human TAF9 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human TAF9 pAb
PA12648-02 100 μL

Rabbit Anti-Human TAF9 pAb

Sign In for Pricing
View Details
Recombinant Human CTLA-4 Protein
orb2994294-01 10 µg

Recombinant Human CTLA-4 Protein

Sign In for Pricing
View Details
Recombinant Human CTLA-4 Protein
orb2994294-02 50 µg

Recombinant Human CTLA-4 Protein

Sign In for Pricing
View Details