Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF R beta, Rat (HEK293, His)

PDGF R beta Protein, a receptor tyrosine kinase, binds ligands PDGFA, PDGFB, and PDGFD, forming homodimers or heterodimers.Ligand binding activates diverse signaling cascades in PDGF R beta, with responses contingent on the specific ligand.The modulation of responses involves heterodimer formation with another receptor, PDGFRB.PDGF R beta Protein, Rat (HEK293, His) is the recombinant rat-derived PDGF R beta protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PDGF R beta Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-r-beta-protein-rat-hek293-his.html

Purity

95.00

Smiles

LVITPPGPEFVLNISSTFVLTCSSSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFIGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINVTVIENGYVRLLETLEDVQIAELHRSRTLQVVFEAYPTPSVLWFKDNRTLGDSSAGELVLSTRNVSETRYVSELTLVRVKVSEAGYYTMRAFHADDQVQLSFKLQVNVPVRVLELSESHPANGEQILRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGRDSQEVTVVPHSLPFKV

Molecular Formula

24629 (Gene_ID) Q05030 (L32-V531) (Accession)

Molecular Weight

80-110 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHmL (NM_001821) Human Tagged Lenti ORF Clone
RC218675L4 10 µg

CHmL (NM_001821) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Polyribonucleotide nucleotidyltransferase (pnp), partial
MBS1026433 Inquire

Recombinant Clostridium botulinum Polyribonucleotide nucleotidyltransferase (pnp), partial

Sign In for Pricing
View Details
Rat Prkaca ELISA Kit
ELI-06163r 96 Tests

Rat Prkaca ELISA Kit

Sign In for Pricing
View Details
Anti-Bcl-6 (Follicular Lymphoma Marker) Monoclonal Antibody (Clone: BCL6/1527)
36-3109-100 100 µg

Anti-Bcl-6 (Follicular Lymphoma Marker) Monoclonal Antibody (Clone: BCL6/1527)

Sign In for Pricing
View Details
SIAIS100
T75012-01 5 mg

SIAIS100

Sign In for Pricing
View Details
SIAIS100
T75012-02 50 mg

SIAIS100

Sign In for Pricing
View Details