Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free TNF-beta/TNFSF1, Mouse (His)

The animal-free TNF beta protein acts as a homotrimeric cytokine that binds TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM.Animal-Free TNF-beta/TNFSF1 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTNF beta protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free TNF-beta/TNFSF1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-tnf-beta-protein-mouse-his.html

Purity

95.00

Smiles

LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL

Molecular Formula

16992 (Gene_ID) P09225 (L34-L202) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FEV CRISPRa sgRNA lentivector (set of three targets)(Human)
20466121 3x 1.0µg DNA

FEV CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Med8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6338307 1.0 µg DNA

Med8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
CD28 (T-cell-specific Surface Glycoprotein CD28, TP44, MGC138290) (Biotin)
137694-Biotin 100 µL

CD28 (T-cell-specific Surface Glycoprotein CD28, TP44, MGC138290) (Biotin)

Sign In for Pricing
View Details
6-Hydroxy Chlorzoxazone-d2
438638-01 500 µg

6-Hydroxy Chlorzoxazone-d2

Sign In for Pricing
View Details
6-Hydroxy Chlorzoxazone-d2
438638-02 1 mg

6-Hydroxy Chlorzoxazone-d2

Sign In for Pricing
View Details
GNB2 Antibody
30-389 100 µL

GNB2 Antibody

Sign In for Pricing
View Details