Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cy5-ProTx-II

Cy5-ProTx-II is a fluorescently labeled ProTx-II, a famous Nav1.7 blocker. The wild type ProTx-II blocks Nav1.7 with an IC50 value of around 300 pM, Nav1.2, Nav1.5 and Nav1.6 with IC50 values of 41 nM, 79 nM and 26 nM respectively. The Cy5-ProTx-II version developed by Smartox has potent Nav1.7 blocking activity. It was shown to fully block Nav1.7 at 100 nM concentration

Product Specifications

Specifications

Nav1.7 selective blocker

Target

Na channels

Sequence

YCQKWMWTCDSERKCCEGMVCRLWCKKKLW

Peptide Number

PTF002

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys25

N Terminal Sequence

Cy5

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf2 Rabbit Polyclonal Antibody (HRP)
orb2111258 100 µL

C19orf2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
CSDC2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-11823R-BF680 100 µL

CSDC2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
NCAM1 Antibody (C-term)
MBS9231920-01 0.1 mL

NCAM1 Antibody (C-term)

Sign In for Pricing
View Details
NCAM1 Antibody (C-term)
MBS9231920-02 5x 0.1 mL

NCAM1 Antibody (C-term)

Sign In for Pricing
View Details
Six1 Lentiviral Activation Particles (h2)
sc-402063-LAC-2 200 µL

Six1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Iron (III) chloride hexahydrate
sc-311566D 250 g

Iron (III) chloride hexahydrate

Sign In for Pricing
View Details