Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19orf2 Rabbit Polyclonal Antibody (HRP)

C19orf2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RMP, URI, NNX3, C19orf2, PPP1R19

UniProt

Q6NX55

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C19orf2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_604431

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin Z, 23-306aa, Mouse, His tag, Insect cell
E53A01436 50 µg

Cathepsin Z, 23-306aa, Mouse, His tag, Insect cell

Sign In for Pricing
View Details
FXRD1, CT (FOXRED1, FAD-dependent oxidoreductase domain-containing protein 1) (FITC) discontinued
035811-FITC 200 µL

FXRD1, CT (FOXRED1, FAD-dependent oxidoreductase domain-containing protein 1) (FITC) discontinued

Sign In for Pricing
View Details
AMIGO2 Polyclonal Antibody
E55A01320 100 µg

AMIGO2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-HLA-C Antibody Picoband® (Carrier-free Conjugate)
PB9377-carrier-free 100 µg/Vial

Anti-HLA-C Antibody Picoband® (Carrier-free Conjugate)

Sign In for Pricing
View Details
Lipoxin A4 ELISA Kit
ECP7899 1 Each

Lipoxin A4 ELISA Kit

Sign In for Pricing
View Details
Canine Tektin-2 (TEKT2) ELISA Kit
MBS9900830-01 48 Well

Canine Tektin-2 (TEKT2) ELISA Kit

Sign In for Pricing
View Details