Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hainantoxin-IV

Hainantoxin-IV (HNTX-IV) is a peptide that was originally isolated from the venom of the Chinese bird spider Ornithoctonus hainana Liang (Selenocosmia hainana Liang) . It has been reported that this peptide is a potent antagonist of tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels (VGSCs) . Hainantoxin-IV binds to TTX-S with an IC50value of 34 nM in adult rat dorsal root ganglion (DRG) neurons. Tetrodotoxin-resistant (TTX-R) voltage-gated sodium channels are not affected by Hainantoxin-IV. It probably interacts with the site 1 through a mechanism quite similar to that of TTX without affecting the activation and inactivation kinetics.

Product Specifications

Specifications

Blocker of voltage-gated sodium channels

Target

Na channels

Sequence

ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI

Peptide Number

12HTX001

Disulfide Bonds

Cys2-Cys17; Cys9-Cys24; ; Cys16-Cys31

N Terminal Sequence

H

C Terminal Sequence

NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PAK4+PAK5+PAK6 (S474 + S560 + S602) Recombinant Rabbit Monoclonal Antibody [JE57-42]
HA722146 100 µL

Phospho-PAK4+PAK5+PAK6 (S474 + S560 + S602) Recombinant Rabbit Monoclonal Antibody [JE57-42]

Sign In for Pricing
View Details
MARCKS pSer158 Rabbit Polyclonal Antibody
AP02531PU-S 50 µL

MARCKS pSer158 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KCNJ13/Kir7.1 Rabbit Polyclonal Antibody
HA500215 100 µL

KCNJ13/Kir7.1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NIPA1 (NM_001142275) Human Over-expression Lysate
LC427999 20 µg

NIPA1 (NM_001142275) Human Over-expression Lysate

Sign In for Pricing
View Details
Sfswap (BC013466) Mouse Tagged ORF Clone
MG200211 10 µg

Sfswap (BC013466) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Inoculating Loops
M4027 1000 Units/Case

Inoculating Loops

Sign In for Pricing
View Details