Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Complement C5a, Cynomolgus

Complement C5 is activated by C5 convertase, inducing C5-C9 assembly to form the membrane attack complex. The transient C6 binding site on C5b is critical for the formation of the cleavage complex. Complement C5a Protein, Cynomolgus is the recombinant cynomolgus-derived Complement C5/C5a protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Complement C5a Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/complement-c5-c5a-protein-cynomolgus.html

Purity

98.00

Smiles

MLQEKIEEIAAKYKHLVVKKCCYDGVRINHDETCEQRAARISVGPRCVKAFTECCVVASQLRANNSHKDLQLGR

Molecular Formula

102125658 (Gene_ID) XP_015292262.1 (M678-R751) (Accession)

Molecular Weight

Approximately 11 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BmP02
HY-P5157 1 Each

BmP02

Sign In for Pricing
View Details
Ppp2r2c sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7590007 1.0 µg DNA

Ppp2r2c sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
TBX18 (T-Box 18) (MaxLight 550)
252427-ML550 100 µL

TBX18 (T-Box 18) (MaxLight 550)

Sign In for Pricing
View Details
Rat C4b-binding protein alpha chain ELISA Kit
MBS2887135-01 48 Well

Rat C4b-binding protein alpha chain ELISA Kit

Sign In for Pricing
View Details
Rat C4b-binding protein alpha chain ELISA Kit
MBS2887135-02 96 Well

Rat C4b-binding protein alpha chain ELISA Kit

Sign In for Pricing
View Details
Rat C4b-binding protein alpha chain ELISA Kit
MBS2887135-03 5x 96 Well

Rat C4b-binding protein alpha chain ELISA Kit

Sign In for Pricing
View Details