Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gamborg's B-5 Medium
CP009-010 10x 1 L

Gamborg's B-5 Medium

Sign In for Pricing
View Details
Dap3 (NM_022994) Mouse Recombinant Protein
PM46721M5 20 µg

Dap3 (NM_022994) Mouse Recombinant Protein

Sign In for Pricing
View Details
Hsc70 Antibody
ASA-B0896 1 Each

Hsc70 Antibody

Sign In for Pricing
View Details
WNT7A Protein Vector (Human) (pPM-C-HA)
PV046443 500 ng

WNT7A Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal E-Selectin/CD62E Antibody (P2H3) [Alexa Fluor 700]
NBP1-43393AF700 0.1 mL

Mouse Monoclonal E-Selectin/CD62E Antibody (P2H3) [Alexa Fluor 700]

Sign In for Pricing
View Details
Anti-POLR2A CTD-T4 (Rabbit)
A119312 100 µL

Anti-POLR2A CTD-T4 (Rabbit)

Sign In for Pricing
View Details