Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Lamin-A/C Antibody, Affinity Purified
A303-430A-T 2 µg

Rabbit anti-Lamin-A/C Antibody, Affinity Purified

Sign In for Pricing
View Details
Mouse Monoclonal Dkk-3 Antibody (103B5) [PerCP]
NBP2-60242PCP 0.1 mL

Mouse Monoclonal Dkk-3 Antibody (103B5) [PerCP]

Sign In for Pricing
View Details
NUSAP1 Protein Vector (Human) (pPM-C-HA)
PV029287 500 ng

NUSAP1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Retinoid X Receptor Alpha (RXRA) Antibody
abx032344-01 80 µL

Retinoid X Receptor Alpha (RXRA) Antibody

Sign In for Pricing
View Details
Retinoid X Receptor Alpha (RXRA) Antibody
abx032344-02 400 µL

Retinoid X Receptor Alpha (RXRA) Antibody

Sign In for Pricing
View Details
Rabbit anti-PC4 Antibody, Affinity Purified
A301-161A-T 2 µg

Rabbit anti-PC4 Antibody, Affinity Purified

Sign In for Pricing
View Details