Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DRB4 Polyclonal Antibody
RD87155A-01 60 μL

HLA-DRB4 Polyclonal Antibody

Sign In for Pricing
View Details
HLA-DRB4 Polyclonal Antibody
RD87155A-02 120 μL

HLA-DRB4 Polyclonal Antibody

Sign In for Pricing
View Details
HLA-DRB4 Polyclonal Antibody
RD87155A-03 200 µL

HLA-DRB4 Polyclonal Antibody

Sign In for Pricing
View Details
PI 4 Kinase type 2 beta (PI4K2B) (NM_018323) Human Over-expression Lysate
LC402666 20 µg

PI 4 Kinase type 2 beta (PI4K2B) (NM_018323) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral mouse Eppk1 shRNA (UAS) - Lentiviral mouse Eppk1 shRNA (UAS, RFP) (25)
GTR15192875 1 Vial

Lentiviral mouse Eppk1 shRNA (UAS) - Lentiviral mouse Eppk1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
BMS-1
HY-19991-01 5 mg

BMS-1

Sign In for Pricing
View Details