Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPINT2 sgRNA CRISPR Lentivector (Human) (Target 3)
K2276904 1.0 µg DNA

SPINT2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-FcRn (FCGRT & B2M) Reference Antibody (orilanolimab)
M09198-3 100 µg

Anti-FcRn (FCGRT & B2M) Reference Antibody (orilanolimab)

Sign In for Pricing
View Details
Pirb (NM_031713) Rat Tagged ORF Clone Lentiviral Particle
RR211988L3V 200 µL

Pirb (NM_031713) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FGFR2 beta (IIIb), His, Cynomolgus
Z04132-500 500 µg

FGFR2 beta (IIIb), His, Cynomolgus

Sign In for Pricing
View Details
Rat Dlx4 Pre-designed siRNA Set A
SI203846A 1 Each

Rat Dlx4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
C6ORF21 antibody
70R-1743 100 ug

C6ORF21 antibody

Sign In for Pricing
View Details