Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ess2 Mouse shRNA Lentiviral Particle (Locus ID 27886)
TL515968V 500 µL Each

Ess2 Mouse shRNA Lentiviral Particle (Locus ID 27886)

Sign In for Pricing
View Details
Arachidonic acid
TBW00878 20mg

Arachidonic acid

Sign In for Pricing
View Details
Uts2 Mouse shRNA Lentiviral Particle (Locus ID 24111)
TL519119V 500 µL Each

Uts2 Mouse shRNA Lentiviral Particle (Locus ID 24111)

Sign In for Pricing
View Details
Anti-TNFRSF6B antibody
PAab08826 100 µg

Anti-TNFRSF6B antibody

Sign In for Pricing
View Details
MSK1 Antibody
MBS9509749-01 0.05 mL

MSK1 Antibody

Sign In for Pricing
View Details
MSK1 Antibody
MBS9509749-02 0.1 mL

MSK1 Antibody

Sign In for Pricing
View Details