Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HE4 antibody
STJ400098 1 mg

Anti-HE4 antibody

Sign In for Pricing
View Details
Mouse Trpc6 ELISA KIT
ELI-51646m 96 Tests

Mouse Trpc6 ELISA KIT

Sign In for Pricing
View Details
PEPT1 discontinued
392927 200 µL

PEPT1 discontinued

Sign In for Pricing
View Details
Acyp2 (BC027642) Mouse Recombinant Protein
TP500286 20 µg

Acyp2 (BC027642) Mouse Recombinant Protein

Sign In for Pricing
View Details
Olr1413 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV635676 1.0 µg DNA

Olr1413 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
S100 Calcium Binding Protein A13 (S100A13) (NM_001024211) Human Over-expression Lysate
LC422619 20 µg

S100 Calcium Binding Protein A13 (S100A13) (NM_001024211) Human Over-expression Lysate

Sign In for Pricing
View Details