Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fgfr4 sgRNA CRISPR Lentivector set (Rat)
K6769201 3x 1.0 µg

Fgfr4 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Il23r sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3749406 1.0 µg DNA

Il23r sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Mouse Adck2 (NM_178873) AAV Particle
MR209458A1V 250 µL

Mouse Adck2 (NM_178873) AAV Particle

Sign In for Pricing
View Details
Rabbit Polyclonal TRIM5 alpha Antibody [Janelia Fluor 646]
NBP1-76601JF646 0.1 mL

Rabbit Polyclonal TRIM5 alpha Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
SARS-CoV-2 Spike NTD Protein, His Tag (BA.2/Omicron) (MALS verified)
SPD-C522h-100ug 100 µg

SARS-CoV-2 Spike NTD Protein, His Tag (BA.2/Omicron) (MALS verified)

Sign In for Pricing
View Details
MMP2 Antibody
E38PA1748 100 µL

MMP2 Antibody

Sign In for Pricing
View Details