Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal UBE2J1 Antibody
NBP1-78065 0.1 mg

Rabbit Polyclonal UBE2J1 Antibody

Sign In for Pricing
View Details
RN5S66 ORF Vector (Human) (pORF)
ORF029467 1.0 µg DNA

RN5S66 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Lentiviral mouse Cfap206 shRNA (UAS) - Lentiviral mouse Cfap206 shRNA (UAS, RFP) (25)
GTR15147827 1 Vial

Lentiviral mouse Cfap206 shRNA (UAS) - Lentiviral mouse Cfap206 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
KIR2DL4, Recombinant, Human, aa24-242, hIgG-His-Tag (Killer Cell Immunoglobulin-like Receptor 2DL4, CD158D, G9P, KIR-103AS, KIR-2DL4, KIR103, KIR103AS)
377873 10 µg

KIR2DL4, Recombinant, Human, aa24-242, hIgG-His-Tag (Killer Cell Immunoglobulin-like Receptor 2DL4, CD158D, G9P, KIR-103AS, KIR-2DL4, KIR103, KIR103AS)

Sign In for Pricing
View Details
TRBV10-3 sgRNA CRISPR Lentivector set (Human)
K2453401 3x 1.0 µg

TRBV10-3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Human PCNXL4 siRNA
abx927980-01 15 nmol

Human PCNXL4 siRNA

Sign In for Pricing
View Details