Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Belantamab Biosimilar - Research Grade
ICH5383-20mg 20 mg

Belantamab Biosimilar - Research Grade

Sign In for Pricing
View Details
Rabbit Anti-Defensin beta 2 antibody
SL1296R-01 50 µL

Rabbit Anti-Defensin beta 2 antibody

Sign In for Pricing
View Details
Rabbit Anti-Defensin beta 2 antibody
SL1296R-02 100 µL

Rabbit Anti-Defensin beta 2 antibody

Sign In for Pricing
View Details
MPDZ sgRNA CRISPR Lentivector set (Human)
K1319601 3x 1.0 µg

MPDZ sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Ziprasidone hydrochloride 10mM * 1mL in DMSO
A16790-10mM-D 10 mM x 1mL in DMSO

Ziprasidone hydrochloride 10mM * 1mL in DMSO

Sign In for Pricing
View Details
RAB31 (RAB31, Member RAS Oncogene Family, Rab22B) (MaxLight 550)
250782-ML550 100 µL

RAB31 (RAB31, Member RAS Oncogene Family, Rab22B) (MaxLight 550)

Sign In for Pricing
View Details