Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG4, Rat (HEK293, His)

The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, His) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-rat-hek293-his.html

Purity

95.00

Smiles

DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP

Molecular Formula

445583 (Gene_ID) Q68AX7 (D23-P157) (Accession)

Molecular Weight

Approximately 20-31 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FANCG (-/-) RKO Cell Line
ABC-KH5338 1 Vial

Human FANCG (-/-) RKO Cell Line

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) slc44a2 Polyclonal Antibody
MBS7199171 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) slc44a2 Polyclonal Antibody

Sign In for Pricing
View Details
Carisoprodol (Soma) (BSA) discontinued
470472 1 mg

Carisoprodol (Soma) (BSA) discontinued

Sign In for Pricing
View Details
ATP5G2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV682270 1.0 µg DNA

ATP5G2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Phospho-Chk1 (S280) (9M10) Rabbit Monoclonal Antibody
AMRe05874-01 50 µL

Phospho-Chk1 (S280) (9M10) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Phospho-Chk1 (S280) (9M10) Rabbit Monoclonal Antibody
AMRe05874-02 100 µL

Phospho-Chk1 (S280) (9M10) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details