Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNPY3/PRAT4A, Human (HEK293, Fc)

CNPY3/PRAT4A is a Toll-like receptor (TLR) -specific co-chaperone of HSP90B1 and is essential for correct TLR folding (except TLR3) . It ensures controlled TLR exit from the endoplasmic reticulum, affecting innate and adaptive immune responses. CNPY3/PRAT4A Protein, Human (HEK293, Fc) is the recombinant human-derived CNPY3/PRAT4A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CNPY3/PRAT4A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnpy3-prat4a-protein-human-hek293-fc.html

Purity

97.0

Smiles

GPSQAGAEENDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIGTGYGILDQKASGVKYTKSDLRLIEVTETICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAEQWSGKKGDTAALGGKKSKKKSSRAKAAGGRSSSSKQRKELGGLEGDPSPEEDEGIQKASPLTHSP

Molecular Formula

10695 (Gene_ID) Q9BT09-1 (G31-P274) (Accession)

Molecular Weight

Approximately 60-70 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pom121-set siRNA/shRNA/RNAi Lentivector (Rat)
37206096 4x 500 ng

Pom121-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Rabbit Activated Protein C Resistance ELISA Kit
MBS014107 Inquire

Rabbit Activated Protein C Resistance ELISA Kit

Sign In for Pricing
View Details
Anti-a-Synuclein (Ab-133) SNCA Antibody
A00215-2 100 µL

Anti-a-Synuclein (Ab-133) SNCA Antibody

Sign In for Pricing
View Details
ZNF569 Peptide - N-terminal region
MBS3227312-01 0.1 mg

ZNF569 Peptide - N-terminal region

Sign In for Pricing
View Details
ZNF569 Peptide - N-terminal region
MBS3227312-02 5x 0.1 mg

ZNF569 Peptide - N-terminal region

Sign In for Pricing
View Details
Active SIRT6 (His-tagged), human recombinant
7699-1000 1 mg

Active SIRT6 (His-tagged), human recombinant

Sign In for Pricing
View Details