Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG1, Human (Biotinylated, HEK293, Avi)

The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived IgG1 protein, expressed by HEK293 , with C-Avi labeled tag.

Product Specifications

Product Name Alternative

IgG1 Protein, Human (Biotinylated, HEK293, Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ighg1-protein-human-hek-293-avi.html

Purity

95.0

Smiles

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCEVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Formula

3500 (Gene_ID) P01857-1 (D104-K330, D239E, L241M) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR16 AAV Vector (Mouse) (CMV)
50302104 1 µg

WDR16 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Bottles, Dropping, Amber Coloured
2060801/2 1 Each

Bottles, Dropping, Amber Coloured

Sign In for Pricing
View Details
PLenti-MAGEA3 shRNA-2
PPLAV13661-2 1 Each

PLenti-MAGEA3 shRNA-2

Sign In for Pricing
View Details
Mouse Anti-Chicken CD44 Monoclonal Antibody-[Biotin]
VD7N282 1 Each

Mouse Anti-Chicken CD44 Monoclonal Antibody-[Biotin]

Sign In for Pricing
View Details
Cd74 Antibody
A16628-50UG 50 µg

Cd74 Antibody

Sign In for Pricing
View Details
CHMP1A shRNA (m) Lentiviral Particles
sc-60368-V 200 µL

CHMP1A shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details