Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG1, Human (Biotinylated, HEK293, Avi)

The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived IgG1 protein, expressed by HEK293 , with C-Avi labeled tag.

Product Specifications

Product Name Alternative

IgG1 Protein, Human (Biotinylated, HEK293, Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ighg1-protein-human-hek-293-avi.html

Purity

95.0

Smiles

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCEVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Formula

3500 (Gene_ID) P01857-1 (D104-K330, D239E, L241M) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcna4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6830206 1.0 µg DNA

Kcna4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
DCP2, ID (DCP2, NUDT20, m7GpppN-mRNA hydrolase, Nucleoside diphosphate-linked moiety X motif 20, mRNA-decapping enzyme 2) (MaxLight 550) discontinued
034514-ML550 100 µL

DCP2, ID (DCP2, NUDT20, m7GpppN-mRNA hydrolase, Nucleoside diphosphate-linked moiety X motif 20, mRNA-decapping enzyme 2) (MaxLight 550) discontinued

Sign In for Pricing
View Details
SMG8 Human Pre-designed siRNA Set A
HY-RS13434 1 Set

SMG8 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
ALB (Albumin, Serum Albumin, GIG20, GIG42, PRO0903, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696/PRO1341) (MaxLight 550)
MBS6369414-01 0.1 mL

ALB (Albumin, Serum Albumin, GIG20, GIG42, PRO0903, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696/PRO1341) (MaxLight 550)

Sign In for Pricing
View Details
ALB (Albumin, Serum Albumin, GIG20, GIG42, PRO0903, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696/PRO1341) (MaxLight 550)
MBS6369414-02 5x 0.1 mL

ALB (Albumin, Serum Albumin, GIG20, GIG42, PRO0903, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696/PRO1341) (MaxLight 550)

Sign In for Pricing
View Details
KRT4, CT (Keratin, Type II Cytoskeletal 4, Cytokeratin-4, CK-4, Keratin-4, K4, CYK4, Type-II Keratin Kb4) (MaxLight 750) discontinued
K0199-05B-ML750 100 µL

KRT4, CT (Keratin, Type II Cytoskeletal 4, Cytokeratin-4, CK-4, Keratin-4, K4, CYK4, Type-II Keratin Kb4) (MaxLight 750) discontinued

Sign In for Pricing
View Details