Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG1, Human (Biotinylated, HEK293, Avi)

The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived IgG1 protein, expressed by HEK293 , with C-Avi labeled tag.

Product Specifications

Product Name Alternative

IgG1 Protein, Human (Biotinylated, HEK293, Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ighg1-protein-human-hek-293-avi.html

Purity

95.0

Smiles

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCEVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Formula

3500 (Gene_ID) P01857-1 (D104-K330, D239E, L241M) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ppp1r7 (NM_023200) AAV Particle
MR205541A1V 250 µL

Mouse Ppp1r7 (NM_023200) AAV Particle

Sign In for Pricing
View Details
Mouse Eosinophil Chemotactic Factor (ECF) CLIA Kit
abx190507-01 96 Tests

Mouse Eosinophil Chemotactic Factor (ECF) CLIA Kit

Sign In for Pricing
View Details
Mouse Eosinophil Chemotactic Factor (ECF) CLIA Kit
abx190507-02 5x 96 Tests

Mouse Eosinophil Chemotactic Factor (ECF) CLIA Kit

Sign In for Pricing
View Details
Mouse Eosinophil Chemotactic Factor (ECF) CLIA Kit
abx190507-03 10x 96 Tests

Mouse Eosinophil Chemotactic Factor (ECF) CLIA Kit

Sign In for Pricing
View Details
MS4A3 (NM_001031809) Human 3' UTR Clone
SC210868 10 µg

MS4A3 (NM_001031809) Human 3' UTR Clone

Sign In for Pricing
View Details
Mouse Monoclonal PLCXD1 Antibody (OTI2D7) [Dylight 594]
NBP2-73458DL594 0.1 mL

Mouse Monoclonal PLCXD1 Antibody (OTI2D7) [Dylight 594]

Sign In for Pricing
View Details