Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Mouse (224a.a, HEK293, His)

The CD74 protein is significantly expressed in the thymus and lymph nodes, suggesting that it plays a key role in regulating immune system function. Its presence in the thymus, a key site for T cell development, underscores its important role in overseeing key cellular processes required for immune maturation. CD74 Protein, Mouse (224a.a, HEK293, His) is the recombinant mouse-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Mouse (224a.a, HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-mouse-224a-a-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL

Molecular Formula

16149 (Gene_ID) P04441-1 (Q56-L279) (Accession)

Molecular Weight

40-55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-EphB6 antibody
STJ98037 100 µl

Anti-EphB6 antibody

Ask
View Details
Human TMCC2 Knockout A549 cell line
GTR15416814 1 Vial

Human TMCC2 Knockout A549 cell line

Ask
View Details
Multiple organ tumor tissue array, including pathology grade, TNM and clinical stage (lung small cell carcinoma reference AJCC 8th version, others reference AJCC 7th version), 24 cores/48 cores, replacing MC485
MC485a 1 Each

Multiple organ tumor tissue array, including pathology grade, TNM and clinical stage (lung small cell carcinoma reference AJCC 8th version, others reference AJCC 7th version), 24 cores/48 cores, replacing MC485

Ask
View Details
FCGR3 Protein (C-His, Rhesus)
P524569 100 µg

FCGR3 Protein (C-His, Rhesus)

Ask
View Details