IL-10, Human
IL-10 Protein, Human is an anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.
Product Specifications
Product Name Alternative
IL-10 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-10-protein-human.html
Purity
97.60
Smiles
SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Molecular Formula
3586 (Gene_ID) P22301/NP_000563.1 (S19-N178) (Accession)
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Fedorak RN, et al. Recombinant human interleukin 10 in the treatment of patients with mild to moderately active Crohn's disease. The Interleukin 10 Inflammatory Bowel Disease Cooperative Study Group. Gastroenterology. 2000 Dec;119 (6) :1473-82.|[2]Chakraborty A, et al. Pharmacodynamic interaction of recombinant human interleukin-10 and prednisolone using in vitro whole blood lymphocyte proliferation. J Pharm Sci. 2002 May;91 (5) :1334-42.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AS10 1096 1 mg
Goat anti-Mouse IgG (H&L), DyLight® 488 conjugated, min, cross-reactivity to bovine, goat, human, rabbit, rat IgG
Sign In for Pricing
View Details RC207042L2V 200 µL
AZIN2 (NM_052998) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
LV764503 1.0 µg DNA
IGHVII-40-1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
Sign In for Pricing
View Details