Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Miraculin protein

This Plant Miraculin protein spans the amino acid sequence from region 30-220aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Miraculin, MIR

UniProt

P13087

Expression Region

30-220aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Synsepalum dulcificum (Miracle fruit) (Richadella dulcifica)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 30-220aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vpr Antibody
orb843936 2 mg

Vpr Antibody

Sign In for Pricing
View Details
RHOT1P3 Recombinant Protein (Human)
RP086808 100 µg

RHOT1P3 Recombinant Protein (Human)

Sign In for Pricing
View Details
TSC22 domain family, member 4 (TSC22D4) Human qPCR Template Standard (NM_030935)
HK211244 1 Kit

TSC22 domain family, member 4 (TSC22D4) Human qPCR Template Standard (NM_030935)

Sign In for Pricing
View Details
Canine Sirtuin 3
GTR10391779 96 Well

Canine Sirtuin 3

Sign In for Pricing
View Details
NBPF21P AAV Vector (Human) (CMV)
31518101 1 µg

NBPF21P AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
CD7 Antibody
V4559-100UG 100 µg

CD7 Antibody

Sign In for Pricing
View Details