Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Outer membrane A/OmpA, E.coli (His-SUMO)

Outer membrane protein A (OmpA) ensures the structural integrity of the bacterial cell wall and cooperates with TolR to stabilize the peptidoglycan layer. As a porin, OmpA controls the permeability of small solutes. Outer membrane protein A/OmpA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane protein A/OmpA protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

Outer membrane protein A/OmpA Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/outer-membrane-protein-a-ompa-protein-e-coli-his-sumo.html

Purity

97.00

Smiles

WTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA

Molecular Formula

917123 (Gene_ID) P0A911 (W164-A346) (Accession)

Molecular Weight

Approximately 35.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108E-01 50 Tests

APC Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
APC Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108E-02 100 Tests

APC Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
APC Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108E-03 2x 100 Tests

APC Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
Recombinant Human ZWINT Protein (His Tag)
PKSH033243-01 10 µg

Recombinant Human ZWINT Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ZWINT Protein (His Tag)
PKSH033243-02 50 µg

Recombinant Human ZWINT Protein (His Tag)

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details