Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAA4, Human (His)

SAA4 Protein, a notable acute phase reactant, plays a pivotal role in responding to physiological challenges. As a crucial apolipoprotein within the HDL complex, SAA4 regulates lipid metabolism and is integral to high-density lipoprotein dynamics. Elevated during acute phase responses, SAA4 underscores its significance in the adaptive mechanisms to diverse stressors. SAA4 Protein, Human (His) is the recombinant human-derived SAA4 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SAA4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/saa4-protein-human-his.html

Purity

95

Smiles

ESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY

Molecular Formula

6291 (Gene_ID) P35542 (E19-Y130) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GluR2 Recombinant Rabbit Monoclonal Antibody [JU20-43]
ET1706-06 100 µL

GluR2 Recombinant Rabbit Monoclonal Antibody [JU20-43]

Sign In for Pricing
View Details
Axin 2 (AXIN2) (NM_004655) Human Over-expression Lysate
LY401475 100 µg

Axin 2 (AXIN2) (NM_004655) Human Over-expression Lysate

Sign In for Pricing
View Details
6,7-Dinitro-2,3-dihydro-benzo[1,4]dioxime
TRC-D479780-25MG 25 mg

6,7-Dinitro-2,3-dihydro-benzo[1,4]dioxime

Sign In for Pricing
View Details
Zfp300 Mouse Gene Knockout Kit (CRISPR)
KN519781 1 Kit

Zfp300 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(R,S)-Nornicotine
TRC-N757000-25MG 25 mg

(R,S)-Nornicotine

Sign In for Pricing
View Details
Cholesterol Benzoate
TRC-C432200-25G 25 g

Cholesterol Benzoate

Sign In for Pricing
View Details