Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFAIP1 siRNA (Mouse)

SiRNA to inhibit TNFAIP1 expression using RNA interference

Product Specifications

Product Name Alternative

EDP1; BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2; BTB/POZ domain-containing protein TNFAIP1; Tumor necrosis factor. alpha-induced protein 1. endothelial

Reactivity

Mouse

Source

Synthetic

Purity

> 97%

Form

Liquid

Storage Conditions

Shipped at 4 °C. Store at -20 °C for one year.

Notes

For research use only.

Applications Notes

Components: We offers pre-designed sets of 3 different target-specific siRNA oligo duplexes of mouse TNFAIP1 gene. Each vial contains 5 nmol of lyophilized siRNA. The duplexes can be transfected individually or pooled together to achieve knockdown of the target gene, which is most commonly assessed by qPCR or western blot. Directions for Use: We recommends transfection with 10 nM - 100 nM siRNA 48 to 72 hours prior to cell lysis. Before resuspending, briefly centrifuge the tube to ensure the lyophilized siRNA is at the bottom of the tube. Resuspend the siRNA oligos to an appropriate concentration with DEPC water. For example, resuspend one tube of 5 nmol siRNA oligo in 250 μl of DEPC water to get a final concentration of 20 μM

Tested Applications

RNA-I

Entrez

21927, 0

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
orb1981203-01 5 mg

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
orb1981203-02 50 mg

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
TLR3, NT (Toll-like Receptor 3, CD283) (PE) discontinued
T8050-20F-PE 200 µL

TLR3, NT (Toll-like Receptor 3, CD283) (PE) discontinued

Sign In for Pricing
View Details
C13orf18 (Uncharacterized Protein KIAA0226-like, FLJ21562, FLJ43762, KIAA0226L) (MaxLight 405)
MBS6371568-01 0.1 mL

C13orf18 (Uncharacterized Protein KIAA0226-like, FLJ21562, FLJ43762, KIAA0226L) (MaxLight 405)

Sign In for Pricing
View Details
C13orf18 (Uncharacterized Protein KIAA0226-like, FLJ21562, FLJ43762, KIAA0226L) (MaxLight 405)
MBS6371568-02 5x 0.1 mL

C13orf18 (Uncharacterized Protein KIAA0226-like, FLJ21562, FLJ43762, KIAA0226L) (MaxLight 405)

Sign In for Pricing
View Details
Human 6-phosphofructokinase, muscle type ELISA Kit
MBS2886525-01 48 Well

Human 6-phosphofructokinase, muscle type ELISA Kit

Sign In for Pricing
View Details