VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
This 30-amino-acid α2δ-1Tat peptide mimics the C-terminal of α2δ-1 and disrupts its interaction with NMDARs. It serves as a valuable research tool for studying neuropathic pain mechanisms in both in vitro and in vivo experimental models.
Product Specifications
Field of Research
Neuroscience, Pharmacology & Drug Discovery
Molecular Weight
3490.06
Storage Conditions
-20°C
Notes
For research use only.
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog