Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

This 30-amino-acid α2δ-1Tat peptide mimics the C-terminal of α2δ-1 and disrupts its interaction with NMDARs. It serves as a valuable research tool for studying neuropathic pain mechanisms in both in vitro and in vivo experimental models.

Product Specifications

Field of Research

Neuroscience, Pharmacology & Drug Discovery

Molecular Weight

3490.06

Storage Conditions

-20°C

Notes

For research use only.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-100 1x 100 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-100 1x 100 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), 1mg/mL
BNUM1037-50 1x 50 µL

CD44 Standard (DF1485), 1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10/13 (DE-K13), CF640R conjugate, 0.1mg/mL
BNC400696-100 1x 100 µL

Cytokeratin 10/13 (DE-K13), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1365), CF405S conjugate, 0.1mg/mL
BNC041365-500 1x 500 µL

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1365), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-1 (SUMO1/1188), CF640R conjugate, 0.1mg/mL
BNC401188-500 1x 500 µL

SUMO-1 (SUMO1/1188), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details