Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4EBP1, Human (His)

EIF4EBP1 is a translation initiation repressor protein that complexly regulates EIF4E activity. In the hypophosphorylated state, EIF4EBP1 competes with EIF4G1/EIF4G3 to inhibit translation by binding to EIF4E. EIF4EBP1 Protein, Human (His) is the recombinant human-derived EIF4EBP1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

EIF4EBP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eif4ebp1-protein-human-his.html

Purity

98.0

Smiles

MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Molecular Formula

1978 (Gene_ID) Q13541 (M1-I118) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRODH Mouse Monoclonal Antibody [Clone ID: OTI1H6]
CF810559 100 µg

PRODH Mouse Monoclonal Antibody [Clone ID: OTI1H6]

Sign In for Pricing
View Details
Mouse Ddx5 activation kit by CRISPRa
GA201048 1 Kit

Mouse Ddx5 activation kit by CRISPRa

Sign In for Pricing
View Details
Urine Exosome Purification and RNA Isolation Midi Kit
58700 25 Preparations

Urine Exosome Purification and RNA Isolation Midi Kit

Sign In for Pricing
View Details
4-(1-Pyrrolidinylsulforylmenthyl)phenylhydrazine Hydrochloride
TRC-P998560-1G 1 g

4-(1-Pyrrolidinylsulforylmenthyl)phenylhydrazine Hydrochloride

Sign In for Pricing
View Details
MAST4 Antibody
KC-7401-01 50 μL

MAST4 Antibody

Sign In for Pricing
View Details
MAST4 Antibody
KC-7401-02 100 µL

MAST4 Antibody

Sign In for Pricing
View Details