Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Claudin-1 (Cldn1), partial

Product Specifications

Product Name Alternative

Claudin-1

Abbreviation

Recombinant Rat Cldn1 protein, partial

Gene Name

Cldn1

UniProt

P56745

Expression Region

29-81aa

Organism

Rattus norvegicus (Rat)

Target Sequence

QWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Claudins function as major constituents of the tight junction complexes that regulate the permeability of epithelia. While some claudin family members play essential roles in the formation of impermeable barriers, others mediate the permeability to ions and small molecules. Often, several claudin family members are coexpressed and interact with each other, and this determines the overall permeability. CLDN1 is required to prevent the paracellular diffusion of small molecules through tight junctions in the epidermis and is required for the normal barrier function of the skin. Required for normal water homeostasis and to prevent excessive water loss through the skin, probably via an indirect effect on the expression levels of other proteins, since CLDN1 itself seems to be dispensable for water barrier formation in keratinocyte tight junctions (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.4 kDa

References & Citations

"Claudin-1 is not restricted to tight junctions in the rat epididymis." Gregory M., Dufresne J., Hermo L., Cyr D. Endocrinology 142:854-863 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Desacetyl-6-bromo-N-Boc Palbociclib
TRC-D445873-50MG 50 mg

6-Desacetyl-6-bromo-N-Boc Palbociclib

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD138/Syndecan-1 Antibody[B-B4]
E-AB-F1411G-01 20 Tests

PE/Cyanine5 Anti-Human CD138/Syndecan-1 Antibody[B-B4]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD138/Syndecan-1 Antibody[B-B4]
E-AB-F1411G-02 100 Tests

PE/Cyanine5 Anti-Human CD138/Syndecan-1 Antibody[B-B4]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD138/Syndecan-1 Antibody[B-B4]
E-AB-F1411G-03 2x 100 Tests

PE/Cyanine5 Anti-Human CD138/Syndecan-1 Antibody[B-B4]

Sign In for Pricing
View Details
Eph receptor A4 (EPHA4) Human Gene Knockout Kit (CRISPR)
KN211230BN 1 Kit

Eph receptor A4 (EPHA4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Cleaved PARP1 p85 Monoclonal Antibody
AN301495L-01 50 µL

Recombinant Cleaved PARP1 p85 Monoclonal Antibody

Sign In for Pricing
View Details