Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eukaryotic translation initiation factor 1A, Y-chromosomal (EIF1AY)

Recombinant Human Eukaryotic translation initiation factor 1A, Y-chromosomal (EIF1AY)

Product Specifications

Product Name Alternative

Eukaryotic translation initiation factor 4C

UniProt

O14602

Expression Region

2-144aa

Tag

N-terminal GST-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL2BP Rabbit Polyclonal Antibody
TA366126 100 µL

ARL2BP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vibrio cholerae TaqMan PCR Lyophilized Kits
TM38550L 100 Reactions

Vibrio cholerae TaqMan PCR Lyophilized Kits

Sign In for Pricing
View Details
CYP1B1 (NM_000104) Human Over-expression Lysate
LY400032 100 µg

CYP1B1 (NM_000104) Human Over-expression Lysate

Sign In for Pricing
View Details
PacBlue succinimidyl ester [equivalent to Pacific Blue succinimidyl ester]
570-AAT 5 mg

PacBlue succinimidyl ester [equivalent to Pacific Blue succinimidyl ester]

Sign In for Pricing
View Details
Caspase 3 (CASP3) Rabbit Monoclonal Antibody [Clone ID: R06-1B2]
TA383874 100 µL

Caspase 3 (CASP3) Rabbit Monoclonal Antibody [Clone ID: R06-1B2]

Sign In for Pricing
View Details
Tunicamycin
SIH-397-5MG 5 mg

Tunicamycin

Sign In for Pricing
View Details